StarFunc result for job id Q9Y4P8

User Input

>input (454 residues)
MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGYKFFSLSS
VDKLEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTIL
AVKLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSAT
IGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVFSIPEGQKLFE
FRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVKEKPPEEPTTWTGYFGKVLM
ASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQKIPRLLVGAADGYLYMYNLD
PQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYT
DDLGAVGGACLEDEASALRLDEDSEHPPMILRTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R823	0.827	0.827	7.433E-78	454	1.000	1.000	A0A024R823.pdb.gz
2	AFDB:A0A024R8L5	0.759	0.772	4.233E-55	446	0.535	0.545	A0A024R8L5.pdb.gz
3	AFDB:M9PER1	0.740	0.751	2.016E-49	447	0.518	0.526	M9PER1.pdb.gz	M9PER1_DROME Autophagy-related 18a, isoform E OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
4	AFDB:O16466	0.693	0.761	3.709E-41	412	0.355	0.391	O16466.pdb.gz	ATG18_CAEEL Autophagy-related protein 18 OS=Caenorhabditis elegans OX=6239 GN=atg-18 PE=1 SV=1
5	AFDB:Q9VIE1	0.713	0.688	5.282E-41	471	0.423	0.408	Q9VIE1.pdb.gz	Q9VIE1_DROME Autophagy-related 18b, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg18b PE=2 SV=2
6	AFDB:Q9HDZ7	0.639	0.774	2.985E-34	373	0.300	0.365	Q9HDZ7.pdb.gz	ATG18_SCHPO Autophagy-related protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg18 PE=1 SV=1
7	AFDB:P43601	0.645	0.588	3.432E-32	500	0.273	0.248	P43601.pdb.gz	ATG18_YEAST Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG18 PE=1 SV=1
8	PDB:6kybB	0.633	0.866	7.966E-32	330	0.271	0.373	6kybB.pdb.gz
9	AFDB:Q93VB2	0.639	0.681	4.683E-29	425	0.244	0.261	Q93VB2.pdb.gz	AT18A_ARATH Autophagy-related protein 18a OS=Arabidopsis thaliana OX=3702 GN=ATG18A PE=1 SV=1
10	AFDB:Q54SA0	0.656	0.841	2.129E-28	350	0.264	0.343	Q54SA0.pdb.gz	Q54SA0_DICDI WD repeat domain phosphoinositide-interacting protein 3 OS=Dictyostelium discoideum OX=44689 GN=wdr45l PE=4 SV=1
11	AFDB:Q9P6N1	0.634	0.849	2.708E-26	335	0.198	0.269	Q9P6N1.pdb.gz	MG179_SCHPO Autophagy-related protein 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug179 PE=1 SV=1
12	PDB:6iyyA	0.622	0.890	6.409E-25	312	0.225	0.327	6iyyA.pdb.gz
13	PDB:7qdrC	0.516	0.737	5.976E-13	305	0.101	0.151	7qdrC.pdb.gz
14	PDB:7mq8LO	0.320	0.178	1.041E-12	848	0.112	0.060	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5nnzA	0.491	0.643	1.410E-12	335	0.104	0.140	5nnzA.pdb.gz
16	PDB:5mzhB	0.479	0.519	1.814E-12	415	0.104	0.113	5mzhB.pdb.gz
17	PDB:6lqsB1	0.331	0.195	3.006E-12	806	0.097	0.055	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
18	PDB:7jvrB	0.484	0.623	3.325E-12	342	0.095	0.126	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
19	PDB:5wyjBA	0.299	0.187	3.869E-12	755	0.128	0.077	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
20	PDB:7ajtUA	0.313	0.189	3.869E-12	834	0.112	0.061	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80W47	0.0	869	445	0.932	0.951	WIPI2_MOUSE WD repeat domain phosphoinositide-interacting protein 2 OS=Mus musculus OX=10090 GN=Wipi2 PE=1 SV=1
2	Q9Y4P8	0.0	944	454	1.000	1.000	WIPI2_HUMAN WD repeat domain phosphoinositide-interacting protein 2 OS=Homo sapiens OX=9606 GN=WIPI2 PE=1 SV=1
3	Q5MNZ9	7.32e-166	476	446	0.533	0.543	WIPI1_HUMAN WD repeat domain phosphoinositide-interacting protein 1 OS=Homo sapiens OX=9606 GN=WIPI1 PE=1 SV=3
4	Q8R3E3	1.42e-164	473	446	0.526	0.536	WIPI1_MOUSE WD repeat domain phosphoinositide-interacting protein 1 OS=Mus musculus OX=10090 GN=Wipi1 PE=1 SV=1
5	M9PHS3	3.39e-151	436	372	0.485	0.591	M9PHS3_DROME Autophagy-related 18a, isoform F OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
6	Q9VSF0	1.94e-150	434	377	0.489	0.589	Q9VSF0_DROME Autophagy-related 18a, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=2
7	M9PEY7	7.13e-150	435	435	0.485	0.506	M9PEY7_DROME Autophagy-related 18a, isoform D OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
8	M9PER1	4.08e-149	434	447	0.489	0.497	M9PER1_DROME Autophagy-related 18a, isoform E OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
9	Q9VIE1	8.15e-110	334	471	0.407	0.393	Q9VIE1_DROME Autophagy-related 18b, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg18b PE=2 SV=2
10	O16466	8.25e-96	296	412	0.333	0.367	ATG18_CAEEL Autophagy-related protein 18 OS=Caenorhabditis elegans OX=6239 GN=atg-18 PE=1 SV=1
11	Q9HDZ7	6.58e-64	212	373	0.300	0.365	ATG18_SCHPO Autophagy-related protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg18 PE=1 SV=1
12	Q54SA0	4.53e-40	149	350	0.260	0.337	Q54SA0_DICDI WD repeat domain phosphoinositide-interacting protein 3 OS=Dictyostelium discoideum OX=44689 GN=wdr45l PE=4 SV=1
13	Q9P6N1	1.19e-34	134	335	0.203	0.275	MG179_SCHPO Autophagy-related protein 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug179 PE=1 SV=1
14	Q93VB2	3.59e-33	132	425	0.236	0.252	AT18A_ARATH Autophagy-related protein 18a OS=Arabidopsis thaliana OX=3702 GN=ATG18A PE=1 SV=1
15	Q5MNZ6	4.74e-33	129	344	0.240	0.317	WIPI3_HUMAN WD repeat domain phosphoinositide-interacting protein 3 OS=Homo sapiens OX=9606 GN=WDR45B PE=1 SV=2
16	Q9P3W2	7.87e-25	107	364	0.167	0.209	HSV2_SCHPO SVP1-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsv2 PE=3 SV=1
17	P43601	3.44e-24	107	500	0.141	0.128	ATG18_YEAST Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG18 PE=1 SV=1
18	Q9Y484	3.98e-21	96.7	360	0.123	0.156	WIPI4_HUMAN WD repeat domain phosphoinositide-interacting protein 4 OS=Homo sapiens OX=9606 GN=WDR45 PE=1 SV=1
19	Q02887	2.41e-15	80.5	496	0.156	0.143	ATG21_YEAST Autophagy-related protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG21 PE=1 SV=1
20	P50079	4.42e-14	76.3	448	0.152	0.154	HSV2_YEAST SVP1-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSV2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	5.9	18.6	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08553 VID27	6.2e+02	10.8	VID27 C-terminal WD40-like domain
3	PF00400 WD40	0.098	24.8	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288828

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375872	0.999	Autophagy-related protein 16-1
2	9606.ENSP00000425107	0.995	Ubiquitin-like protein ATG12
3	9606.ENSP00000358072	0.990	Autophagy protein 5
4	9606.ENSP00000283290	0.987	Ubiquitin-like-conjugating enzyme ATG3
5	9606.ENSP00000366475	0.987	Autophagy-related protein 2 homolog A
6	9606.ENSP00000266458	0.986	Gamma-aminobutyric acid receptor-associated protein-like 1
7	9606.ENSP00000363970	0.986	Microtubule-associated proteins 1A/1B light chain 3A
8	9606.ENSP00000306866	0.984	Gamma-aminobutyric acid receptor-associated protein
9	9606.ENSP00000037243	0.983	Gamma-aminobutyric acid receptor-associated protein-like 2
10	9606.ENSP00000353010	0.981	Autophagy-related protein 2 homolog B
11	9606.ENSP00000404923	0.974	Tectonin beta-propeller repeat-containing protein 1
12	9606.ENSP00000268607	0.972	Microtubule-associated proteins 1A/1B light chain 3B
13	9606.ENSP00000349785	0.972	Microtubule-associated proteins 1A/1B light chain 3C
14	9606.ENSP00000355231	0.970	Beclin-1
15	9606.ENSP00000346437	0.961	Ubiquitin-like modifier-activating enzyme ATG7
16	9606.ENSP00000262039	0.960	Phosphatidylinositol 3-kinase catalytic subunit type 3
17	9606.ENSP00000349205	0.944	Phosphoinositide 3-kinase regulatory subunit 4
18	9606.ENSP00000247178	0.932	Beclin 1-associated autophagy-related key regulator
19	9606.ENSP00000025008	0.927	RB1-inducible coiled-coil protein 1
20	9606.ENSP00000326340	0.913	Autophagy-related protein 16-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032266	1.000	phosphatidylinositol-3-phosphate binding
GO:0043167	0.994	ion binding
GO:0080025	0.877	phosphatidylinositol-3,5-bisphosphate binding
GO:0010314	0.764	phosphatidylinositol-5-phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0006996	0.990	organelle organization
GO:0006914	0.987	autophagy
GO:0016236	0.977	macroautophagy
GO:0007033	0.969	vacuole organization
GO:0070925	0.968	organelle assembly
GO:0050896	0.960	response to stimulus
GO:0051179	0.957	localization
GO:0051641	0.946	cellular localization
GO:0000045	0.944	autophagosome assembly
GO:0008104	0.932	protein localization
GO:0033554	0.928	cellular response to stress
GO:0007154	0.919	cell communication
GO:0009267	0.906	cellular response to starvation
GO:0050794	0.808	regulation of cellular process
GO:0071704	0.605	organic substance metabolic process
GO:0019222	0.584	regulation of metabolic process
GO:0043170	0.574	macromolecule metabolic process
GO:0044238	0.534	primary metabolic process
GO:0048518	0.432	positive regulation of biological process
GO:0031323	0.432	regulation of cellular metabolic process
GO:0006807	0.415	nitrogen compound metabolic process
GO:0010506	0.406	regulation of autophagy
GO:0048522	0.381	positive regulation of cellular process
GO:0009893	0.348	positive regulation of metabolic process
GO:0019538	0.340	protein metabolic process
GO:0006810	0.320	transport
GO:0036211	0.320	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005654	0.992	nucleoplasm
GO:0005829	0.986	cytosol
GO:0016020	0.944	membrane
GO:0000407	0.804	phagophore assembly site
GO:0005773	0.744	vacuole
GO:0012505	0.656	endomembrane system
GO:0005776	0.582	autophagosome
GO:0032991	0.534	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]