StarFunc result for job id Q9Y4P9

User Input

>input (236 residues)
MASSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPAN
SLQQKLSNWGHLNRKVLKRLNFSVPDDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQ
GAGSLQELAPQDGSGYMDVGVSQKARGEGVPDPQGGGQLSWDRPPAPRPPAYNRALQGDP
SFVLQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIEDLSRRLQQAERKQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y4P9	1.000	1.000	6.102E-32	236	1.000	1.000	Q9Y4P9.pdb.gz	SPEF1_HUMAN Sperm flagellar protein 1 OS=Homo sapiens OX=9606 GN=SPEF1 PE=1 SV=3
2	AFDB:Q99JL1	0.556	0.560	1.342E-27	234	0.881	0.889	Q99JL1.pdb.gz	SPEF1_MOUSE Sperm flagellar protein 1 OS=Mus musculus OX=10090 GN=Spef1 PE=1 SV=1
3	AFDB:Q0IH24	0.552	0.569	1.555E-19	229	0.564	0.581	Q0IH24.pdb.gz	SPEF1_XENLA Sperm flagellar protein 1 OS=Xenopus laevis OX=8355 GN=spef1 PE=2 SV=1
4	AFDB:Q583Z0	0.511	0.440	2.623E-13	275	0.373	0.320	Q583Z0.pdb.gz	Q583Z0_TRYB2 Calponin-homology (CH) domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.580 PE=4 SV=1
5	AFDB:Q57VY9	0.397	0.096	6.965E-4	1009	0.144	0.034	Q57VY9.pdb.gz	Q57VY9_TRYB2 CH-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.870 PE=4 SV=1
6	AFDB:Q7XJ60	0.391	0.338	3.426E-3	276	0.136	0.116	Q7XJ60.pdb.gz	EB1A_ARATH Microtubule-associated protein RP/EB family member 1A OS=Arabidopsis thaliana OX=3702 GN=EB1A PE=1 SV=1
7	AFDB:Q9FJJ5	0.387	0.316	3.426E-3	293	0.131	0.106	Q9FJJ5.pdb.gz	EB1B_ARATH Microtubule-associated protein RP/EB family member 1B OS=Arabidopsis thaliana OX=3702 GN=EB1B PE=1 SV=1
8	AFDB:Q5XIT1	0.379	0.324	5.934E-3	281	0.182	0.153	Q5XIT1.pdb.gz	MARE3_RAT Microtubule-associated protein RP/EB family member 3 OS=Rattus norvegicus OX=10116 GN=Mapre3 PE=1 SV=1
9	AFDB:Q15691	0.371	0.331	1.353E-2	268	0.148	0.131	Q15691.pdb.gz	MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3
10	AFDB:Q8BYJ2	0.353	0.288	1.595E-2	301	0.165	0.130	Q8BYJ2.pdb.gz	Q8BYJ2_MOUSE Calponin-homology (CH) domain-containing protein OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1
11	PDB:2r8uB	0.347	0.565	8.682E-2	136	0.064	0.110	2r8uB.pdb.gz	Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal domain at 1.35 A resolution
12	PDB:7sqcC2	0.393	0.066	1.207E-1	1498	0.097	0.015	7sqcC2.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:7n6g6A	0.323	0.056	1.773E-1	1558	0.097	0.015	7n6g6A.pdb.gz	Cryo-EM structure of an active central apparatus.
14	PDB:7sx8D	0.331	0.188	5.320E-1	448	0.068	0.036	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
15	PDB:4d1eA	0.352	0.107	9.736E-1	859	0.064	0.017	4d1eA.pdb.gz
16	PDB:7mq8NJ	0.141	0.057	1.989	827	0.059	0.017	7mq8NJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:3ipmO	0.106	0.116	2.101	219	0.089	0.096	3ipmO.pdb.gz
18	PDB:7aqrV	0.088	0.131	2.220	140	0.076	0.129	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
19	PDB:7mq8SB	0.153	0.096	2.765	440	0.097	0.052	7mq8SB.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7mqaSS	0.090	0.068	3.086	350	0.131	0.089	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y4P9	5.45e-173	477	236	1.000	1.000	SPEF1_HUMAN Sperm flagellar protein 1 OS=Homo sapiens OX=9606 GN=SPEF1 PE=1 SV=3
2	Q99JL1	5.72e-138	388	234	0.881	0.889	SPEF1_MOUSE Sperm flagellar protein 1 OS=Mus musculus OX=10090 GN=Spef1 PE=1 SV=1
3	Q0IH24	2.09e-84	252	229	0.576	0.594	SPEF1_XENLA Sperm flagellar protein 1 OS=Xenopus laevis OX=8355 GN=spef1 PE=2 SV=1
4	Q583Z0	9.29e-41	142	275	0.280	0.240	Q583Z0_TRYB2 Calponin-homology (CH) domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.580 PE=4 SV=1
5	Q8NEY3	1.11e-13	70.9	305	0.148	0.115	SPAT4_HUMAN Spermatogenesis-associated protein 4 OS=Homo sapiens OX=9606 GN=SPATA4 PE=1 SV=1
6	Q8K3V1	1.08e-08	56.6	295	0.131	0.105	SPAT4_MOUSE Spermatogenesis-associated protein 4 OS=Mus musculus OX=10090 GN=Spata4 PE=1 SV=1
7	Q57VY9	3.89e-04	43.5	1009	0.131	0.031	Q57VY9_TRYB2 CH-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.870 PE=4 SV=1
8	B3NQ14	0.33	34.3	445	0.093	0.049	CGLR1_DROER Cyclic GMP-AMP synthase-like receptor 1 OS=Drosophila erecta OX=7220 GN=GG20550 PE=3 SV=1
9	Q9ZUJ5	0.50	33.5	360	0.093	0.061	5MMP_ARATH Metalloendoproteinase 5-MMP OS=Arabidopsis thaliana OX=3702 GN=5MMP PE=1 SV=1
10	Q13395	1.1	32.7	1621	0.085	0.012	TARB1_HUMAN Probable methyltransferase TARBP1 OS=Homo sapiens OX=9606 GN=TARBP1 PE=1 SV=1
11	Q07963	1.2	32.7	1872	0.102	0.013	UBR2_YEAST E3 ubiquitin-protein ligase UBR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBR2 PE=1 SV=1
12	A0A8I6GLW6	3.9	30.4	173	0.064	0.087	A0A8I6GLW6_RAT YEATS domain containing 4 OS=Rattus norvegicus OX=10116 GN=Yeats4 PE=1 SV=1
13	Q38CF6	5.2	30.8	1719	0.093	0.013	Q38CF6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7320 PE=4 SV=1
14	Q9CR11	6.8	30.0	227	0.059	0.062	YETS4_MOUSE YEATS domain-containing protein 4 OS=Mus musculus OX=10090 GN=Yeats4 PE=2 SV=1
15	O75962	7.9	30.4	3097	0.085	0.006	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
16	O95619	8.6	29.6	227	0.059	0.062	YETS4_HUMAN YEATS domain-containing protein 4 OS=Homo sapiens OX=9606 GN=YEATS4 PE=1 SV=1
17	Q8IVL1	9.3	30.0	2488	0.059	0.006	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
18	Q9VY98	9.4	30.0	789	0.076	0.023	Q9VY98_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Mrgn1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	2.1e-11	54.8	CAMSAP CH domain
2	PF00307 CH	1.6e+02	13.9	Calponin homology (CH) domain
3	PF06294 CH_2	6.4e-30	114.4	CH-like domain in sperm protein
4	PF04859 DUF641	9.8e+02	11.5	Plant protein of unknown function (DUF641)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369080

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233121	0.837	Microtubule-associated protein RP/EB family member 3
2	9606.ENSP00000364721	0.776	Microtubule-associated protein RP/EB family member 1
3	9606.ENSP00000252456	0.764	Calponin-1
4	9606.ENSP00000439287	0.559	Regulating synaptic membrane exocytosis protein 4
5	9606.ENSP00000248706	0.532	Ras-like protein family member 11B
6	9606.ENSP00000307567	0.522	Glutamine--tRNA ligase
7	9606.ENSP00000369840	0.522	Testis-expressed protein 26
8	9606.ENSP00000317376	0.521	Mitochondrial ribosomal protein S11
9	9606.ENSP00000313309	0.509	Protein fuzzy homolog
10	9606.ENSP00000365811	0.504	Sperm-associated antigen 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	1.000	cytoskeletal protein binding
GO:0003779	0.913	actin binding
GO:0008017	0.699	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0030031	0.991	cell projection assembly
GO:0120036	0.984	plasma membrane bounded cell projection organization
GO:0050794	0.977	regulation of cellular process
GO:0048519	0.971	negative regulation of biological process
GO:0120031	0.912	plasma membrane bounded cell projection assembly
GO:0048523	0.879	negative regulation of cellular process
GO:0010941	0.477	regulation of cell death
GO:0097581	0.419	lamellipodium organization
GO:0046847	0.306	filopodium assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005856	1.000	cytoskeleton
GO:0120025	0.999	plasma membrane bounded cell projection
GO:0016020	0.981	membrane
GO:0071944	0.978	cell periphery
GO:0043227	0.978	membrane-bounded organelle
GO:0005886	0.963	plasma membrane
GO:0015630	0.880	microtubule cytoskeleton
GO:0099080	0.727	supramolecular complex
GO:0099512	0.705	supramolecular fiber
GO:0099513	0.643	polymeric cytoskeletal fiber
GO:0005874	0.627	microtubule
GO:0098590	0.444	plasma membrane region
GO:0005829	0.404	cytosol
GO:0005929	0.390	cilium
GO:0099568	0.366	cytoplasmic region
GO:0045178	0.352	basal part of cell
GO:0070013	0.331	intracellular organelle lumen
GO:0016323	0.321	basolateral plasma membrane
GO:0045177	0.305	apical part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]