StarFunc result for job id Q9Y4W2

User Input

>input (734 residues)
MSWESGAGPGLGSQGMDLVWSAWYGKCVKGKGSLPLSAHGIVVAWLSRAEWDQVTVYLFC
DDHKLQRYALNRITVWRSRSGNELPLAVASTADLIRCKLLDVTGGLGTDELRLLYGMALV
RFVNLISERKTKFAKVPLKCLAQEVNIPDWIVDLRHELTHKKMPHINDCRRGCYFVLDWL
QKTYWCRQLENSLRETWELEEFREGIEEEDQEEDKNIVVDDITEQKPEPQDDGKSTESDV
KADGDSKGSEEVDSHCKKALSHKELYERARELLVSYEEEQFTVLEKFRYLPKAIKAWNNP
SPRVECVLAELKGVTCENREAVLDAFLDDGFLVPTFEQLAALQIEYEDGQTEVQRGEGTD
PKSHKNVDLNDVLVPKPFSQFWQPLLRGLHSQNFTQALLERMLSELPALGISGIRPTYIL
RWTVELIVANTKTGRNARRFSAGQWEARRGWRLFNCSASLDWPRMVESCLGSPCWASPQL
LRIIFKAMGQGLPDEEQEKLLRICSIYTQSGENSLVQEGSEASPIGKSPYTLDSLYWSVK
PASSSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEEDEDDEDD
EEEDRMEVGPFSTGQESPTAENARLLAQKRGALQGSAWQVSSEDVRWDTFPLGRMPGQTE
DPAELMLENYDTMYLLDQPVLEQRLEPSTCKTDTLGLSCGVGSGNCSNSSSSNFEGLLWS
QGQLHGLKTGLQLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y4W2	1.000	1.000	6.853E-91	734	1.000	1.000	Q9Y4W2.pdb.gz	LAS1L_HUMAN Ribosomal biogenesis protein LAS1L OS=Homo sapiens OX=9606 GN=LAS1L PE=1 SV=2
2	AFDB:O42874	0.133	0.088	8.283E-4	1462	0.129	0.065	O42874.pdb.gz	STU1_SCHPO Protein peg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=peg1 PE=1 SV=1
3	AFDB:Q84JU6	0.077	0.066	4.917E-2	927	0.132	0.105	Q84JU6.pdb.gz	HOS1_ARATH E3 ubiquitin-protein ligase HOS1 OS=Arabidopsis thaliana OX=3702 GN=HOS1 PE=1 SV=1
4	AFDB:Q57ZA6	0.102	0.066	7.182E-2	1572	0.139	0.065	Q57ZA6.pdb.gz	Q57ZA6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1020 PE=4 SV=1
5	AFDB:Q96UP3	0.098	0.064	7.182E-2	1400	0.110	0.058	Q96UP3.pdb.gz	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1
6	PDB:1wa5C	0.100	0.085	8.437E-2	950	0.082	0.063	1wa5C.pdb.gz	Structural basis for the assembly of a nuclear export complex.
7	PDB:7n6g1N	0.084	0.047	9.985E-2	2179	0.090	0.030	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
8	AFDB:F1M8L9	0.077	0.051	1.350E-1	1253	0.116	0.068	F1M8L9.pdb.gz	F1M8L9_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=1 SV=4
9	PDB:7nj1A	0.072	0.049	2.042E-1	1448	0.097	0.049	7nj1A.pdb.gz
10	AFDB:C8VM39	0.096	0.087	2.435E-1	853	0.134	0.115	C8VM39.pdb.gz	C8VM39_EMENI FarB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01425 PE=4 SV=1
11	AFDB:Q52LW3	0.114	0.075	2.435E-1	1261	0.119	0.069	Q52LW3.pdb.gz	RHG29_HUMAN Rho GTPase-activating protein 29 OS=Homo sapiens OX=9606 GN=ARHGAP29 PE=1 SV=2
12	AFDB:A0A5F8MPI9	0.073	0.052	2.648E-1	1087	0.095	0.064	A0A5F8MPI9.pdb.gz	A0A5F8MPI9_MOUSE Rap guanine nucleotide exchange factor (GEF) 1 OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1
13	PDB:4bujB	0.093	0.064	2.983E-1	1367	0.079	0.042	4bujB.pdb.gz
14	AFDB:O15550	0.085	0.058	3.005E-1	1401	0.121	0.064	O15550.pdb.gz	KDM6A_HUMAN Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2
15	PDB:1wa5B	0.115	0.159	3.530E-1	466	0.083	0.131	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
16	PDB:2z6gA	0.076	0.092	4.178E-1	550	0.082	0.109	2z6gA.pdb.gz
17	PDB:3tpoA	0.123	0.178	4.178E-1	438	0.076	0.128	3tpoA.pdb.gz
18	PDB:7unkA	0.103	0.082	5.157E-1	1047	0.086	0.060	7unkA.pdb.gz
19	PDB:7sicA	0.106	0.049	5.851E-1	2773	0.065	0.017	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
20	PDB:6zz6D	0.089	0.067	6.639E-1	1050	0.082	0.057	6zz6D.pdb.gz	Transport of DNA within cohesin involves clamping on top of engaged heads by Scc2 and entrapment within the ring by Scc3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y4W2	0.0	1504	734	1.000	1.000	LAS1L_HUMAN Ribosomal biogenesis protein LAS1L OS=Homo sapiens OX=9606 GN=LAS1L PE=1 SV=2
2	P36146	5.55e-13	74.3	502	0.074	0.108	LAS1_YEAST Protein LAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAS1 PE=1 SV=1
3	Q57YI3	1.09e-10	66.6	378	0.060	0.116	Q57YI3_TRYB2 Las1-like OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.1140 PE=4 SV=1
4	O42936	8.11e-07	54.7	470	0.045	0.070	LAS1_SCHPO Pre-rRNA-processing protein las1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=las1 PE=1 SV=1
5	Q8I3A0	0.32	37.0	2568	0.023	0.007	Q8I3A0_PLAF7 Copper-transporting ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0904900 PE=4 SV=2
6	Q8IDX6	3.2	33.9	3130	0.027	0.006	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04031 Las1	2.4e-37	139.7	Las1-like
2	PF06524 NOA36	29	15.4	NOA36 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363944

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301396	0.999	Proline-, glutamic acid- and leucine-rich protein 1
2	9606.ENSP00000366934	0.999	Polynucleotide 5'-hydroxyl-kinase NOL9
3	9606.ENSP00000364037	0.997	Testis-expressed protein 10
4	9606.ENSP00000314029	0.993	Sentrin-specific protease 3
5	9606.ENSP00000476117	0.981	WD repeat-containing protein 18
6	9606.ENSP00000406549	0.951	Transcription initiation factor TFIID subunit 1
7	9606.ENSP00000351446	0.943	WD repeat-containing protein 5
8	9606.ENSP00000264515	0.939	Retinoblastoma-binding protein 5
9	9606.ENSP00000407323	0.938	Probable rRNA-processing protein EBP2
10	9606.ENSP00000436786	0.938	Histone-lysine N-methyltransferase 2A
11	9606.ENSP00000363124	0.937	PHD finger protein 20
12	9606.ENSP00000346120	0.928	Nucleolar RNA helicase 2
13	9606.ENSP00000395772	0.922	Guanine nucleotide-binding protein-like 3
14	9606.ENSP00000382863	0.908	Chromodomain-helicase-DNA-binding protein 8
15	9606.ENSP00000318297	0.906	RuvB-like 1
16	9606.ENSP00000324122	0.906	U4/U6 small nuclear ribonucleoprotein Prp31
17	9606.ENSP00000473172	0.906	RuvB-like 2
18	9606.ENSP00000370193	0.903	Transcription initiation factor TFIID subunit 9
19	9606.ENSP00000399982	0.902	Transcription initiation factor TFIID subunit 6
20	9606.ENSP00000219905	0.900	MAX gene-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003824	0.571	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:0043170	0.979	macromolecule metabolic process
GO:0006139	0.960	nucleobase-containing compound metabolic process
GO:0071840	0.954	cellular component organization or biogenesis
GO:0050794	0.949	regulation of cellular process
GO:0006396	0.917	RNA processing
GO:0044085	0.908	cellular component biogenesis
GO:0034660	0.839	ncRNA metabolic process
GO:0080090	0.793	regulation of primary metabolic process
GO:0051171	0.793	regulation of nitrogen compound metabolic process
GO:0031323	0.793	regulation of cellular metabolic process
GO:0022613	0.776	ribonucleoprotein complex biogenesis
GO:0060255	0.772	regulation of macromolecule metabolic process
GO:0010468	0.715	regulation of gene expression
GO:0048518	0.601	positive regulation of biological process
GO:0034470	0.591	ncRNA processing
GO:0042254	0.564	ribosome biogenesis
GO:0019219	0.563	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.462	positive regulation of cellular process
GO:0051252	0.457	regulation of RNA metabolic process
GO:0009889	0.435	regulation of biosynthetic process
GO:0010556	0.417	regulation of macromolecule biosynthetic process
GO:0031326	0.413	regulation of cellular biosynthetic process
GO:0048519	0.382	negative regulation of biological process
GO:0016072	0.360	rRNA metabolic process
GO:2001141	0.353	regulation of RNA biosynthetic process
GO:0006364	0.350	rRNA processing
GO:0006355	0.339	regulation of DNA-templated transcription
GO:0009893	0.300	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071339	0.996	MLL1 complex
GO:0043228	0.956	non-membrane-bounded organelle
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0005737	0.741	cytoplasm
GO:0005694	0.596	chromosome
GO:0005730	0.358	nucleolus
GO:0005829	0.336	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]