StarFunc result for job id Q9Y4W6

User Input

>input (797 residues)
MAHRCLRLWGRGGCWPRGLQQLLVPGGVGPGEQPCLRTLYRFVTTQARASRNSLLTDIIA
AYQRFCSRPPKGFEKYFPNGKNGKKASEPKEVMGEKKESKPAATTRSSGGGGGGGGKRGG
KKDDSHWWSRFQKGDIPWDDKDFRMFFLWTALFWGGVMFYLLLKRSGREITWKDFVNNYL
SKGVVDRLEVVNKRFVRVTFTPGKTPVDGQYVWFNIGSVDTFERNLETLQQELGIEGENR
VPVVYIAESDGSFLLSMLPTVLIIAFLLYTIRRGPAGIGRTGRGMGGLFSVGETTAKVLK
DEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKA
TAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNAPCILFIDEIDAVGRKRGRGN
FGGQSEQENTLNQLLVEMDGFNTTTNVVILAGTNRPDILDPALLRPGRFDRQIFIGPPDI
KGRASIFKVHLRPLKLDSTLEKDKLARKLASLTPGFSGADVANVCNEAALIAARHLSDSI
NQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRG
KGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQ
IVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKK
ADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEFVEGTGSLDEDTSLPEGLKDWN
KEREKEKEEPPGEKVAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LN92	0.917	0.912	0.000	802	0.935	0.929	F1LN92.pdb.gz	F1LN92_RAT AFG3 like matrix AAA peptidase subunit 2 OS=Rattus norvegicus OX=10116 GN=Afg3l2 PE=1 SV=1
2	AFDB:Q920A7	0.709	0.716	0.000	789	0.701	0.708	Q920A7.pdb.gz	AFG31_MOUSE AFG3-like protein 1 OS=Mus musculus OX=10090 GN=Afg3l1 PE=1 SV=2
3	AFDB:Q8T4G5	0.650	0.628	2.219E-97	826	0.616	0.594	Q8T4G5.pdb.gz	Q8T4G5_DROME AFG3 like matrix AAA peptidase subunit 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Afg3l2 PE=1 SV=1
4	AFDB:Q9N3T5	0.696	0.709	1.695E-92	782	0.550	0.560	Q9N3T5.pdb.gz	AFG3_CAEEL AFG3-like protein spg-7 OS=Caenorhabditis elegans OX=6239 GN=spg-7 PE=3 SV=2
5	AFDB:Q8VZI8	0.632	0.621	1.105E-80	813	0.472	0.462	Q8VZI8.pdb.gz	FTSHA_ARATH ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH10 PE=1 SV=1
6	AFDB:P39925	0.684	0.715	1.855E-80	761	0.468	0.490	P39925.pdb.gz	AFG3_YEAST Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AFG3 PE=1 SV=1
7	AFDB:Q5AJC2	0.585	0.586	4.250E-80	795	0.473	0.474	Q5AJC2.pdb.gz	Q5AJC2_CANAL AAA family ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AFG3 PE=3 SV=1
8	AFDB:Q9HGM3	0.627	0.645	1.329E-79	773	0.487	0.502	Q9HGM3.pdb.gz	YTA12_SCHPO Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yta12 PE=3 SV=1
9	AFDB:Q84WU8	0.602	0.593	3.377E-79	809	0.476	0.468	Q84WU8.pdb.gz	FTSH3_ARATH ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH3 PE=1 SV=1
10	AFDB:P40341	0.656	0.636	1.337E-77	825	0.450	0.435	P40341.pdb.gz	YTA12_YEAST Mitochondrial respiratory chain complexes assembly protein YTA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YTA12 PE=1 SV=2
11	PDB:7tdoA	0.457	0.816	1.948E-41	420	0.263	0.500	7tdoA.pdb.gz	Cryo-EM structure of transmembrane AAA+ protease FtsH in the ADP state.
12	PDB:7wi4A	0.450	0.842	2.230E-31	410	0.225	0.437	7wi4A.pdb.gz	Cryo-EM structure of the entire FtsH-HflKC AAA protease complex.
13	PDB:5l4gL	0.302	0.595	6.449E-23	389	0.146	0.298	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
14	PDB:5l4gM	0.307	0.575	1.726E-22	415	0.125	0.241	5l4gM.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
15	PDB:6fvtM	0.307	0.564	1.115E-21	421	0.130	0.247	6fvtM.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
16	PDB:5mp9I	0.289	0.583	3.142E-21	385	0.153	0.317	5mp9I.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
17	PDB:7ln6F	0.281	0.312	3.142E-21	714	0.123	0.137	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
18	PDB:6fvtK	0.306	0.602	5.556E-21	394	0.134	0.272	6fvtK.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
19	PDB:6fvtH	0.301	0.551	1.090E-20	426	0.130	0.244	6fvtH.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
20	PDB:5mp9M	0.309	0.627	2.029E-20	381	0.128	0.268	5mp9M.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZLF3	0.0	1409	773	0.882	0.909	A0A8I5ZLF3_RAT AFG3 like matrix AAA peptidase subunit 2 OS=Rattus norvegicus OX=10116 GN=Afg3l2 PE=1 SV=1
2	F1LN92	0.0	1458	802	0.918	0.913	F1LN92_RAT AFG3 like matrix AAA peptidase subunit 2 OS=Rattus norvegicus OX=10116 GN=Afg3l2 PE=1 SV=1
3	P39925	0.0	659	761	0.434	0.455	AFG3_YEAST Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AFG3 PE=1 SV=1
4	P40341	0.0	673	825	0.433	0.418	YTA12_YEAST Mitochondrial respiratory chain complexes assembly protein YTA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YTA12 PE=1 SV=2
5	Q5AJC2	0.0	676	795	0.447	0.448	Q5AJC2_CANAL AAA family ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AFG3 PE=3 SV=1
6	Q84WU8	0.0	643	809	0.481	0.473	FTSH3_ARATH ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH3 PE=1 SV=1
7	Q8JZQ2	0.0	1459	802	0.916	0.910	AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus OX=10090 GN=Afg3l2 PE=1 SV=1
8	Q8T4G5	0.0	919	826	0.609	0.587	Q8T4G5_DROME AFG3 like matrix AAA peptidase subunit 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Afg3l2 PE=1 SV=1
9	Q8VZI8	0.0	658	813	0.463	0.454	FTSHA_ARATH ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH10 PE=1 SV=1
10	Q920A7	0.0	1047	789	0.690	0.697	AFG31_MOUSE AFG3-like protein 1 OS=Mus musculus OX=10090 GN=Afg3l1 PE=1 SV=2
11	Q9HGM3	0.0	676	773	0.464	0.479	YTA12_SCHPO Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yta12 PE=3 SV=1
12	Q9N3T5	0.0	818	782	0.529	0.540	AFG3_CAEEL AFG3-like protein spg-7 OS=Caenorhabditis elegans OX=6239 GN=spg-7 PE=3 SV=2
13	Q9Y4W6	0.0	1628	797	1.000	1.000	AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens OX=9606 GN=AFG3L2 PE=1 SV=2
14	Q3ULF4	3.92e-179	535	781	0.375	0.383	SPG7_MOUSE Paraplegin OS=Mus musculus OX=10090 GN=Spg7 PE=1 SV=1
15	Q9UQ90	3.51e-178	533	795	0.373	0.374	SPG7_HUMAN Paraplegin OS=Homo sapiens OX=9606 GN=SPG7 PE=1 SV=2
16	Q7TT47	4.82e-178	532	781	0.365	0.373	SPG7_RAT Paraplegin OS=Rattus norvegicus OX=10116 GN=Spg7 PE=2 SV=2
17	Q9W4W8	4.43e-170	513	819	0.381	0.371	Q9W4W8_DROME Paraplegin, isoform A OS=Drosophila melanogaster OX=7227 GN=Spg7 PE=1 SV=1
18	P37476	8.40e-155	468	637	0.300	0.375	FTSH_BACSU ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) OX=224308 GN=ftsH PE=1 SV=1
19	Q9WZ49	7.92e-151	456	610	0.295	0.385	FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=ftsH PE=1 SV=1
20	Q9HV48	1.07e-148	452	639	0.297	0.371	Q9HV48_PSEAE ATP-dependent zinc metalloprotease FtsH OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=ftsH PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.2e-38	144.0	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	5e+02	12.1	AAA domain
3	PF13191 AAA_16	8.1	18.3	AAA ATPase domain
4	PF13207 AAA_17	2.7e+02	13.4	AAA domain
5	PF07724 AAA_2	14	17.3	AAA domain (Cdc48 subfamily)
6	PF13401 AAA_22	0.38	22.5	AAA domain
7	PF13521 AAA_28	4.6e+02	12.4	AAA domain
8	PF13671 AAA_33	3.5e+02	12.8	AAA domain
9	PF07728 AAA_5	5.3	18.5	AAA domain (dynein-related subfamily)
10	PF17862 AAA_lid_3	9.3e-11	52.7	AAA+ lid domain
11	PF06480 FtsH_ext	3.2e-06	38.8	FtsH Extracellular
12	PF02831 gpW	8.8e+02	11.2	gpW
13	PF01695 IstB_IS21	3.1e+02	12.2	IstB-like ATP binding protein
14	PF01078 Mg_chelatase	3e+02	12.2	Magnesium chelatase, subunit ChlI
15	PF01434 Peptidase_M41	1.1e-62	222.8	Peptidase family M41
16	PF05496 RuvB_N	2.8	19.1	Holliday junction DNA helicase RuvB P-loop domain
17	PF06068 TIP49	25	15.6	TIP49 P-loop domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269143

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479488	0.966	Prohibitin
2	9606.ENSP00000249269	0.965	Mitochondrial-processing peptidase subunit beta
3	9606.ENSP00000441875	0.960	Prohibitin-2
4	9606.ENSP00000360782	0.959	Mitochondrial-processing peptidase subunit alpha
5	9606.ENSP00000353826	0.928	Lon protease homolog, mitochondrial
6	9606.ENSP00000423673	0.925	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
7	9606.ENSP00000418803	0.913	Complex I assembly factor TIMMDC1, mitochondrial
8	9606.ENSP00000297185	0.899	Stress-70 protein, mitochondrial
9	9606.ENSP00000264932	0.894	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
10	9606.ENSP00000325421	0.856	Presenilins-associated rhomboid-like protein, mitochondrial
11	9606.ENSP00000373620	0.850	60 kDa heat shock protein, mitochondrial
12	9606.ENSP00000360270	0.844	Metalloendopeptidase OMA1, mitochondrial
13	9606.ENSP00000295079	0.831	m-AAA protease-interacting protein 1, mitochondrial
14	9606.ENSP00000317159	0.830	Cytochrome c1, heme protein, mitochondrial
15	9606.ENSP00000245816	0.814	ATP-dependent Clp protease proteolytic subunit, mitochondrial
16	9606.ENSP00000362144	0.795	Calcium uniporter protein, mitochondrial
17	9606.ENSP00000315774	0.772	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
18	9606.ENSP00000300107	0.770	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial
19	9606.ENSP00000354415	0.765	Calcium uptake protein 1, mitochondrial
20	9606.ENSP00000371811	0.742	Calcium uptake protein 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008233	0.998	peptidase activity
GO:0008237	0.991	metallopeptidase activity
GO:0004175	0.872	endopeptidase activity
GO:0051082	0.818	unfolded protein binding
GO:0004222	0.805	metalloendopeptidase activity
GO:0140657	0.667	ATP-dependent activity
GO:0097159	0.612	organic cyclic compound binding
GO:1901363	0.569	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.995	metabolic process
GO:0009987	0.992	cellular process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0006807	0.962	nitrogen compound metabolic process
GO:0071840	0.938	cellular component organization or biogenesis
GO:1901564	0.938	organonitrogen compound metabolic process
GO:0006508	0.930	proteolysis
GO:0016043	0.915	cellular component organization
GO:0007005	0.436	mitochondrion organization
GO:0044237	0.379	cellular metabolic process
GO:0065007	0.307	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0031090	0.997	organelle membrane
GO:0031967	0.990	organelle envelope
GO:0032991	0.980	protein-containing complex
GO:0031966	0.978	mitochondrial membrane
GO:0005743	0.957	mitochondrial inner membrane
GO:0098798	0.881	mitochondrial protein-containing complex
GO:0098796	0.780	membrane protein complex
GO:0098800	0.755	inner mitochondrial membrane protein complex
GO:1902494	0.560	catalytic complex
GO:0070013	0.342	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.998	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.805	Metalloendopeptidases.

[back to server]