StarFunc result for job id Q9Y4Y9

User Input

>input (91 residues)
MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEIT
PEGRRITKLDQILLNGNNITMLVPGGEGPEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62322	0.953	0.953	1.856E-16	91	1.000	1.000	P62322.pdb.gz	LSM5_MOUSE U6 snRNA-associated Sm-like protein LSm5 OS=Mus musculus OX=10090 GN=Lsm5 PE=3 SV=2
2	AFDB:O18694	0.902	0.902	1.627E-13	91	0.736	0.736	O18694.pdb.gz	O18694_CAEEL U6 snRNA-associated Sm-like protein LSm5 OS=Caenorhabditis elegans OX=6239 GN=lsm-5 PE=1 SV=1
3	AFDB:Q9VRT7	0.930	0.930	2.028E-13	91	0.780	0.780	Q9VRT7.pdb.gz	Q9VRT7_DROME U6 snRNA-associated Sm-like protein LSm5 OS=Drosophila melanogaster OX=7227 GN=BcDNA:RE60135 PE=1 SV=1
4	AFDB:Q9FKB0	0.855	0.884	1.941E-12	88	0.670	0.693	Q9FKB0.pdb.gz	LSM5_ARATH Sm-like protein LSM5 OS=Arabidopsis thaliana OX=3702 GN=LSM5 PE=1 SV=1
5	PDB:3jcr5	0.721	0.851	2.597E-10	76	0.835	1.000	3jcr5.pdb.gz
6	AFDB:P40089	0.757	0.742	2.952E-9	93	0.451	0.441	P40089.pdb.gz	LSM5_YEAST U6 snRNA-associated Sm-like protein LSm5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM5 PE=1 SV=1
7	PDB:5vsuE	0.745	0.777	4.557E-9	87	0.451	0.471	5vsuE.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
8	AFDB:O42978	0.809	0.915	8.409E-9	80	0.473	0.537	O42978.pdb.gz	LSM5_SCHPO U6 snRNA-associated Sm-like protein LSm5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm5 PE=1 SV=2
9	PDB:3swnA	0.779	0.927	1.298E-8	76	0.473	0.566	3swnA.pdb.gz	Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
10	AFDB:A0A1D8PTG5	0.771	0.732	1.321E-7	96	0.220	0.208	A0A1D8PTG5.pdb.gz	A0A1D8PTG5_CANAL U6 snRNA-associated Sm-like protein LSm3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SMX4 PE=3 SV=1
11	PDB:5o9zp	0.753	0.929	1.387E-7	73	0.220	0.274	5o9zp.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
12	PDB:4m77E	0.716	0.924	2.155E-7	70	0.396	0.514	4m77E.pdb.gz
13	AFDB:Q8IGW7	0.717	0.635	3.020E-7	103	0.253	0.223	Q8IGW7.pdb.gz	Q8IGW7_DROME U6 snRNA-associated Sm-like protein LSm3 OS=Drosophila melanogaster OX=7227 GN=LSm3 PE=2 SV=1
14	PDB:3bw1A	0.718	0.757	4.411E-7	86	0.220	0.233	3bw1A.pdb.gz
15	AFDB:P57743	0.741	0.756	5.849E-7	89	0.220	0.225	P57743.pdb.gz	LSM3_YEAST U6 snRNA-associated Sm-like protein LSm3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM3 PE=1 SV=1
16	PDB:6ppnC	0.745	0.897	8.085E-7	75	0.187	0.227	6ppnC.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
17	PDB:6qw663	0.700	0.748	9.027E-7	85	0.242	0.259	6qw663.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	AFDB:Q9ZV45	0.767	0.791	9.088E-7	88	0.297	0.307	Q9ZV45.pdb.gz	Q9ZV45_ARATH Small nuclear ribonucleoprotein E OS=Arabidopsis thaliana OX=3702 GN=PCP PE=1 SV=1
19	PDB:4c92G	0.663	0.792	1.482E-6	75	0.231	0.280	4c92G.pdb.gz
20	PDB:6ppqG	0.692	0.737	1.566E-6	85	0.253	0.271	6ppqG.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62322	1.50e-61	183	91	1.000	1.000	LSM5_MOUSE U6 snRNA-associated Sm-like protein LSm5 OS=Mus musculus OX=10090 GN=Lsm5 PE=3 SV=2
2	Q9Y4Y9	1.50e-61	183	91	1.000	1.000	LSM5_HUMAN U6 snRNA-associated Sm-like protein LSm5 OS=Homo sapiens OX=9606 GN=LSM5 PE=1 SV=3
3	O18694	1.53e-46	145	91	0.736	0.736	O18694_CAEEL U6 snRNA-associated Sm-like protein LSm5 OS=Caenorhabditis elegans OX=6239 GN=lsm-5 PE=1 SV=1
4	Q9VRT7	5.79e-46	144	91	0.769	0.769	Q9VRT7_DROME U6 snRNA-associated Sm-like protein LSm5 OS=Drosophila melanogaster OX=7227 GN=BcDNA:RE60135 PE=1 SV=1
5	Q9FKB0	5.83e-41	131	88	0.670	0.693	LSM5_ARATH Sm-like protein LSM5 OS=Arabidopsis thaliana OX=3702 GN=LSM5 PE=1 SV=1
6	O42978	2.82e-24	89.0	80	0.495	0.562	LSM5_SCHPO U6 snRNA-associated Sm-like protein LSm5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm5 PE=1 SV=2
7	P40089	1.34e-20	80.1	93	0.462	0.452	LSM5_YEAST U6 snRNA-associated Sm-like protein LSm5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM5 PE=1 SV=1
8	Q9ZV45	1.36e-06	44.3	88	0.319	0.330	Q9ZV45_ARATH Small nuclear ribonucleoprotein E OS=Arabidopsis thaliana OX=3702 GN=PCP PE=1 SV=1
9	P62310	2.58e-06	43.9	102	0.286	0.255	LSM3_HUMAN U6 snRNA-associated Sm-like protein LSm3 OS=Homo sapiens OX=9606 GN=LSM3 PE=1 SV=2
10	D3ZSP1	3.84e-06	43.1	92	0.264	0.261	D3ZSP1_RAT Small nuclear ribonucleoprotein E OS=Rattus norvegicus OX=10116 GN=Snrpel1 PE=3 SV=1
11	Q9XTU6	3.85e-06	43.1	90	0.264	0.267	RUXE_CAEEL Probable small nuclear ribonucleoprotein E OS=Caenorhabditis elegans OX=6239 GN=snr-6 PE=3 SV=1
12	P62304	4.23e-06	43.1	92	0.264	0.261	RUXE_HUMAN Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1
13	A0A8I6AA88	4.64e-06	42.7	86	0.242	0.256	A0A8I6AA88_RAT Small nuclear ribonucleoprotein E OS=Rattus norvegicus OX=10116 GN=Snrpe PE=3 SV=1
14	Q9LMN4	7.47e-06	42.7	97	0.209	0.196	LSM3A_ARATH Sm-like protein LSM3A OS=Arabidopsis thaliana OX=3702 GN=LSM3A PE=1 SV=1
15	Q9C6K5	1.09e-05	42.4	98	0.198	0.184	LSM3B_ARATH Sm-like protein LSM3B OS=Arabidopsis thaliana OX=3702 GN=LSM3B PE=1 SV=1
16	Q9U1W8	1.77e-05	41.6	102	0.242	0.216	Q9U1W8_CAEEL U6 snRNA-associated Sm-like protein LSm3 OS=Caenorhabditis elegans OX=6239 GN=lsm-3 PE=1 SV=2
17	Q9VLV5	3.12e-05	40.8	94	0.253	0.245	RUXE_DROME Probable small nuclear ribonucleoprotein E OS=Drosophila melanogaster OX=7227 GN=SmE PE=1 SV=1
18	D6XI03	7.97e-05	39.7	86	0.231	0.244	D6XI03_TRYB2 Small nuclear ribonucleoprotein E OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.160 PE=3 SV=1
19	Q9GYZ3	7.97e-05	39.7	86	0.231	0.244	Q9GYZ3_9TRYP Small nuclear ribonucleoprotein E OS=Trypanosoma brucei OX=5691 GN=Sm-E PE=2 SV=1
20	Q586C5	9.81e-05	40.0	111	0.209	0.171	Q586C5_TRYB2 Small nuclear ribonucleoprotein Sm D2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.295 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01423 LSM	5.2e-17	72.6	LSM domain
2	PF14438 SM-ATX	1.7e+02	13.8	Ataxin 2 SM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008825757.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008819728.1	0.999	LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
2	1026970.XP_008825694.1	0.999	LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated
3	1026970.XP_008835324.1	0.999	LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated
4	1026970.XP_008835395.1	0.999	LSM8 homolog, U6 small nuclear RNA associated
5	1026970.XP_008853159.1	0.999	LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated
6	1026970.XP_008822774.1	0.997	LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
7	1026970.XP_008845975.1	0.992	LSM1 homolog, mRNA degradation associated
8	1026970.XP_008821469.1	0.988	Small nuclear ribonucleoprotein G
9	1026970.XP_008843025.1	0.985	PHD finger-like domain-containing protein 5A
10	1026970.XP_008836103.1	0.979	Small nuclear ribonucleoprotein Sm D3
11	1026970.XP_008850270.1	0.978	Small nuclear ribonucleoprotein Sm D2
12	1026970.XP_008825198.1	0.973	Small nuclear ribonucleoprotein F-like
13	1026970.XP_008830289.1	0.973	Small nuclear ribonucleoprotein F
14	1026970.XP_008847473.1	0.971	Thioredoxin-like protein 4A
15	1026970.XP_008828588.1	0.970	Small nuclear ribonucleoprotein E
16	1026970.XP_008843015.1	0.970	SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5)
17	1026970.XP_008845827.1	0.970	Small nuclear ribonucleoprotein E-like
18	1026970.XP_008828032.1	0.969	Splicing factor 3B subunit 5
19	1026970.XP_008825190.1	0.967	Small nuclear ribonucleoprotein D1 polypeptide
20	1026970.XP_008820502.1	0.966	Squamous cell carcinoma antigen recognized by T-cells 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.965	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016070	0.989	RNA metabolic process
GO:0016071	0.983	mRNA metabolic process
GO:0010467	0.946	gene expression
GO:0008380	0.938	RNA splicing
GO:0000377	0.915	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0065007	0.897	biological regulation
GO:0050789	0.882	regulation of biological process
GO:0006397	0.858	mRNA processing
GO:0050896	0.815	response to stimulus
GO:0000398	0.806	mRNA splicing, via spliceosome
GO:0019222	0.783	regulation of metabolic process
GO:0060255	0.709	regulation of macromolecule metabolic process
GO:0044419	0.624	biological process involved in interspecies interaction between organisms
GO:0009605	0.624	response to external stimulus
GO:0048519	0.588	negative regulation of biological process
GO:0009892	0.550	negative regulation of metabolic process
GO:0009607	0.530	response to biotic stimulus
GO:0044270	0.502	cellular nitrogen compound catabolic process
GO:0010468	0.501	regulation of gene expression
GO:0046700	0.500	heterocycle catabolic process
GO:0043207	0.498	response to external biotic stimulus
GO:0010605	0.496	negative regulation of macromolecule metabolic process
GO:0019439	0.489	aromatic compound catabolic process
GO:1901361	0.487	organic cyclic compound catabolic process
GO:0050794	0.471	regulation of cellular process
GO:0051707	0.452	response to other organism
GO:0044260	0.438	cellular macromolecule metabolic process
GO:0009617	0.405	response to bacterium
GO:0006401	0.380	RNA catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990904	0.998	ribonucleoprotein complex
GO:0140513	0.998	nuclear protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0005737	0.997	cytoplasm
GO:0120114	0.993	Sm-like protein family complex
GO:0120115	0.978	Lsm2-8 complex
GO:0005829	0.957	cytosol
GO:0030532	0.862	small nuclear ribonucleoprotein complex
GO:0097525	0.825	spliceosomal snRNP complex
GO:0005684	0.791	U2-type spliceosomal complex
GO:0046540	0.574	U4/U6 x U5 tri-snRNP complex
GO:0071011	0.441	precatalytic spliceosome
GO:0071005	0.408	U2-type precatalytic spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]