StarFunc result for job id Q9Y4Z2

User Input

>input (214 residues)
MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRK
LRARRGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLT
KIETLRFAHNYIWALTQTLRIADHSLYALEPPAPHCGELGSPGGSPGDWGSLYSPVSQAG
SLSPAASLEERPGLLGATFSACLSPGSLAFSDFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y4Z2	0.999	0.999	6.219E-30	214	1.000	1.000	Q9Y4Z2.pdb.gz	NGN3_HUMAN Neurogenin-3 OS=Homo sapiens OX=9606 GN=NEUROG3 PE=1 SV=2
2	AFDB:O08718	0.480	0.480	7.628E-22	214	0.776	0.776	O08718.pdb.gz	O08718_RAT Neurogenin 3 OS=Rattus norvegicus OX=10116 GN=Neurog3 PE=4 SV=1
3	AFDB:P70447	0.364	0.296	5.889E-9	263	0.402	0.327	P70447.pdb.gz	NGN2_MOUSE Neurogenin-2 OS=Mus musculus OX=10090 GN=Neurog2 PE=1 SV=1
4	AFDB:P70660	0.355	0.312	1.356E-8	244	0.407	0.357	P70660.pdb.gz	NGN1_MOUSE Neurogenin-1 OS=Mus musculus OX=10090 GN=Neurog1 PE=1 SV=1
5	AFDB:O42606	0.372	0.383	7.704E-8	208	0.355	0.365	O42606.pdb.gz	NGN1_DANRE Neurogenin-1 OS=Danio rerio OX=7955 GN=neurog1 PE=2 SV=1
6	AFDB:Q9H2A3	0.359	0.285	1.169E-7	272	0.435	0.342	Q9H2A3.pdb.gz	NGN2_HUMAN Neurogenin-2 OS=Homo sapiens OX=9606 GN=NEUROG2 PE=1 SV=2
7	AFDB:Q92858	0.330	0.204	4.047E-6	354	0.276	0.167	Q92858.pdb.gz	ATOH1_HUMAN Transcription factor ATOH1 OS=Homo sapiens OX=9606 GN=ATOH1 PE=2 SV=1
8	AFDB:Q7RTS1	0.316	0.351	7.564E-6	189	0.266	0.302	Q7RTS1.pdb.gz	BHA15_HUMAN Class A basic helix-loop-helix protein 15 OS=Homo sapiens OX=9606 GN=BHLHA15 PE=1 SV=1
9	AFDB:P70562	0.278	0.301	1.148E-5	197	0.252	0.274	P70562.pdb.gz	BHA15_RAT Class A basic helix-loop-helix protein 15 OS=Rattus norvegicus OX=10116 GN=Bhlha15 PE=1 SV=1
10	AFDB:P48985	0.332	0.208	2.465E-5	351	0.266	0.162	P48985.pdb.gz	ATOH1_MOUSE Transcription factor Atoh1 OS=Mus musculus OX=10090 GN=Atoh1 PE=1 SV=1
11	PDB:3ojaA	0.232	0.119	8.652E-1	482	0.079	0.035	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
12	PDB:6lo8E	0.170	0.375	1.407	80	0.051	0.138	6lo8E.pdb.gz
13	PDB:7bt6r	0.136	0.128	2.454	230	0.065	0.061	7bt6r.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
14	PDB:4v8sAY	0.140	0.087	5.270	376	0.033	0.019	4v8sAY.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
15	PDB:3tixA	0.106	0.130	6.492	153	0.037	0.052	3tixA.pdb.gz
16	PDB:5y27A	0.126	0.214	6.492	98	0.047	0.102	5y27A.pdb.gz
17	PDB:6lulA	0.145	0.141	6.959	224	0.112	0.107	6lulA.pdb.gz
18	PDB:6asyA	0.115	0.042	7.460	606	0.023	0.008	6asyA.pdb.gz	Conformation transitions of the polypeptide-binding pocket support an active substrate release from Hsp70s.
19	PDB:8at3A	0.159	0.122	7.460	286	0.079	0.059	8at3A.pdb.gz
20	PDB:2bskC	0.139	0.343	7.997	79	0.037	0.101	2bskC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y4Z2	1.54e-155	431	214	1.000	1.000	NGN3_HUMAN Neurogenin-3 OS=Homo sapiens OX=9606 GN=NEUROG3 PE=1 SV=2
2	P70661	6.89e-109	313	214	0.762	0.762	NGN3_MOUSE Neurogenin-3 OS=Mus musculus OX=10090 GN=Neurog3 PE=1 SV=1
3	O08718	3.65e-101	293	214	0.743	0.743	O08718_RAT Neurogenin 3 OS=Rattus norvegicus OX=10116 GN=Neurog3 PE=4 SV=1
4	O42606	1.00e-34	124	208	0.266	0.274	NGN1_DANRE Neurogenin-1 OS=Danio rerio OX=7955 GN=neurog1 PE=2 SV=1
5	Q92886	3.21e-34	124	237	0.346	0.312	NGN1_HUMAN Neurogenin-1 OS=Homo sapiens OX=9606 GN=NEUROG1 PE=1 SV=2
6	P70447	9.24e-34	123	263	0.355	0.289	NGN2_MOUSE Neurogenin-2 OS=Mus musculus OX=10090 GN=Neurog2 PE=1 SV=1
7	P70660	1.17e-33	122	244	0.271	0.238	NGN1_MOUSE Neurogenin-1 OS=Mus musculus OX=10090 GN=Neurog1 PE=1 SV=1
8	Q9H2A3	1.33e-33	123	272	0.280	0.221	NGN2_HUMAN Neurogenin-2 OS=Homo sapiens OX=9606 GN=NEUROG2 PE=1 SV=2
9	O16867	3.45e-23	97.8	398	0.234	0.126	TAP_DROME Basic helix-loop-helix neural transcription factor TAP OS=Drosophila melanogaster OX=7227 GN=tap PE=1 SV=2
10	P48986	4.03e-20	88.6	337	0.210	0.134	NDF6_MOUSE Neurogenic differentiation factor 6 OS=Mus musculus OX=10090 GN=Neurod6 PE=2 SV=1
11	Q62414	3.55e-18	84.0	383	0.178	0.099	NDF2_MOUSE Neurogenic differentiation factor 2 OS=Mus musculus OX=10090 GN=Neurod2 PE=1 SV=3
12	Q15784	3.56e-18	84.0	382	0.178	0.099	NDF2_HUMAN Neurogenic differentiation factor 2 OS=Homo sapiens OX=9606 GN=NEUROD2 PE=1 SV=2
13	Q91616	4.80e-18	83.2	352	0.178	0.108	NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus laevis OX=8355 GN=neurod1 PE=1 SV=1
14	Q6NYU3	7.07e-18	82.4	327	0.210	0.138	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
15	P79765	7.74e-18	82.8	357	0.178	0.106	NDF1_CHICK Neurogenic differentiation factor 1 OS=Gallus gallus OX=9031 GN=NEUROD1 PE=2 SV=1
16	Q64289	8.80e-18	82.4	357	0.178	0.106	NDF1_RAT Neurogenic differentiation factor 1 OS=Rattus norvegicus OX=10116 GN=Neurod1 PE=1 SV=1
17	Q60867	8.98e-18	82.4	357	0.178	0.106	NDF1_MOUSE Neurogenic differentiation factor 1 OS=Mus musculus OX=10090 GN=Neurod1 PE=1 SV=2
18	Q13562	9.84e-18	82.4	356	0.178	0.107	NDF1_HUMAN Neurogenic differentiation factor 1 OS=Homo sapiens OX=9606 GN=NEUROD1 PE=1 SV=3
19	O42202	1.83e-17	81.6	350	0.173	0.106	NDF1_DANRE Neurogenic differentiation factor 1 OS=Danio rerio OX=7955 GN=neurod1 PE=1 SV=1
20	F1QWM8	5.87e-17	80.1	348	0.173	0.106	F1QWM8_DANRE Neurogenic differentiation factor OS=Danio rerio OX=7955 GN=ath3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	4.4e-13	60.3	Helix-loop-helix DNA-binding domain
2	PF04817 Umbravirus_LDM	15	16.4	Umbravirus long distance movement (LDM) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242462

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339906	0.993	Paired box protein Pax-4
2	9606.ENSP00000366347	0.985	Homeobox protein Nkx-2.2
3	9606.ENSP00000302630	0.974	Hepatocyte nuclear factor 6
4	9606.ENSP00000312631	0.970	Insulinoma-associated protein 1
5	9606.ENSP00000232424	0.949	Transcription factor HES-1
6	9606.ENSP00000295108	0.924	Neurogenic differentiation factor 1
7	9606.ENSP00000295886	0.903	Homeobox protein Nkx-6.1
8	9606.ENSP00000357581	0.874	Homeobox protein Nkx-6.2
9	9606.ENSP00000370421	0.866	Pancreas/duodenum homeobox protein 1
10	9606.ENSP00000387662	0.848	Glucagon
11	9606.ENSP00000388940	0.846	Transcription factor 12
12	9606.ENSP00000323568	0.816	Solute carrier family 2, facilitated glucose transporter member 2
13	9606.ENSP00000287641	0.811	Somatostatin
14	9606.ENSP00000380432	0.799	Insulin
15	9606.ENSP00000332208	0.797	DNA-binding protein RFX6
16	9606.ENSP00000466009	0.792	Pancreatic prohormone
17	9606.ENSP00000404100	0.757	Paired box protein Pax-6
18	9606.ENSP00000230658	0.731	Insulin gene enhancer protein ISL-1
19	9606.ENSP00000328364	0.731	Transcription factor MafA
20	9606.ENSP00000216492	0.713	Chromogranin-A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001217	0.778	DNA-binding transcription repressor activity
GO:0001227	0.756	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.989	multicellular organismal process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0048856	0.985	anatomical structure development
GO:0080090	0.985	regulation of primary metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0048522	0.984	positive regulation of cellular process
GO:0051171	0.980	regulation of nitrogen compound metabolic process
GO:0010468	0.974	regulation of gene expression
GO:0010556	0.967	regulation of macromolecule biosynthetic process
GO:0006355	0.955	regulation of DNA-templated transcription
GO:0007275	0.927	multicellular organism development
GO:0006357	0.917	regulation of transcription by RNA polymerase II
GO:0007399	0.904	nervous system development
GO:0009987	0.781	cellular process
GO:0009893	0.699	positive regulation of metabolic process
GO:0051254	0.691	positive regulation of RNA metabolic process
GO:0031328	0.677	positive regulation of cellular biosynthetic process
GO:0010557	0.675	positive regulation of macromolecule biosynthetic process
GO:0045893	0.670	positive regulation of DNA-templated transcription
GO:0045944	0.566	positive regulation of transcription by RNA polymerase II
GO:0048519	0.506	negative regulation of biological process
GO:0048523	0.488	negative regulation of cellular process
GO:0050896	0.420	response to stimulus
GO:0048513	0.395	animal organ development
GO:0045892	0.381	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.465	intracellular organelle lumen
GO:0005737	0.360	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]