StarFunc result for job id Q9Y512

User Input

>input (469 residues)
MGTVHARSLEPLPSSGPDFGGLGEEAEFVEVEPEAKQEILENKDVVVQHVHFDGLGRTKD
DIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLIDTCQGDDALPNGLDVTF
EVTELRRLTGSYNTMVGNNEGSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPR
PGNFERNFSVNLYKVTGQFPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSR
TASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDF
ELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSIRGFSMHSIGPQSEGD
YLGGEAYWAGGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAE
CIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BGH2	0.932	0.932	4.869E-82	469	0.959	0.959	Q8BGH2.pdb.gz	SAM50_MOUSE Sorting and assembly machinery component 50 homolog OS=Mus musculus OX=10090 GN=Samm50 PE=1 SV=1
2	AFDB:Q803G5	0.935	0.935	5.326E-78	469	0.840	0.840	Q803G5.pdb.gz	SAM5A_DANRE Sorting and assembly machinery component 50 homolog A OS=Danio rerio OX=7955 GN=samm50a PE=2 SV=1
3	AFDB:Q10478	0.846	0.835	3.899E-40	475	0.284	0.280	Q10478.pdb.gz	SAM50_SCHPO SAM50-like protein SPAC17C9.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17C9.06 PE=3 SV=1
4	AFDB:A0A1D8PKC1	0.831	0.771	8.227E-36	507	0.235	0.217	A0A1D8PKC1.pdb.gz	A0A1D8PKC1_CANAL SAM complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAM50 PE=4 SV=1
5	AFDB:Q9FFG3	0.796	0.716	5.338E-35	524	0.275	0.246	Q9FFG3.pdb.gz	Q9FFG3_ARATH Outer membrane OMP85 family protein OS=Arabidopsis thaliana OX=3702 GN=MOP10.6 PE=1 SV=1
6	AFDB:Q9SRL6	0.795	0.722	3.464E-34	520	0.286	0.258	Q9SRL6.pdb.gz	Q9SRL6_ARATH Outer membrane OMP85 family protein OS=Arabidopsis thaliana OX=3702 GN=F9F8.12 PE=1 SV=1
7	AFDB:P53969	0.764	0.742	2.877E-31	484	0.241	0.233	P53969.pdb.gz	SAM50_YEAST Sorting assembly machinery 50 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAM50 PE=1 SV=1
8	PDB:7e4hA	0.782	0.833	1.320E-29	439	0.224	0.239	7e4hA.pdb.gz
9	AFDB:Q580K4	0.708	0.695	1.668E-26	479	0.213	0.209	Q580K4.pdb.gz	Q580K4_TRYB2 Bacterial surface antigen (D15) domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.640 PE=4 SV=1
10	PDB:7nriA	0.755	0.463	1.767E-25	785	0.194	0.116	7nriA.pdb.gz	The antibiotic darobactin mimics a beta-strand to inhibit outer membrane insertase.
11	AFDB:P0A940	0.772	0.460	2.310E-25	810	0.196	0.114	P0A940.pdb.gz	BAMA_ECOLI Outer membrane protein assembly factor BamA OS=Escherichia coli (strain K12) OX=83333 GN=bamA PE=1 SV=1
12	PDB:7tt7A	0.652	0.621	7.073E-24	496	0.196	0.185	7tt7A.pdb.gz	Cryo-EM structures reveal multiple stages of bacterial outer membrane protein folding.
13	AFDB:A0A1D8PN01	0.656	0.612	2.416E-23	508	0.192	0.177	A0A1D8PN01.pdb.gz	A0A1D8PN01_CANAL Sam51p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAM51 PE=4 SV=1
14	PDB:4c00A	0.697	0.608	1.002E-21	544	0.141	0.121	4c00A.pdb.gz
15	PDB:2hdiA	0.329	0.271	6.070E-6	598	0.092	0.072	2hdiA.pdb.gz
16	PDB:3rfzB	0.272	0.185	5.611E-5	778	0.092	0.055	3rfzB.pdb.gz
17	PDB:5fp2B	0.274	0.249	6.868E-5	538	0.117	0.102	5fp2B.pdb.gz	Structure and Function of the PiuA and PirA Siderophore-Drug Receptors from Pseudomonas aeruginosa and Acinetobacter baumannii.
18	PDB:5c58A	0.287	0.218	1.466E-4	667	0.100	0.070	5c58A.pdb.gz	Binding of HasA by its transmembrane receptor HasR follows a conformational funnel mechanism.
19	PDB:5fp2A	0.314	0.299	1.466E-4	499	0.107	0.100	5fp2A.pdb.gz	Structure and Function of the PiuA and PirA Siderophore-Drug Receptors from Pseudomonas aeruginosa and Acinetobacter baumannii.
20	PDB:6z99B	0.333	0.254	6.348E-4	658	0.092	0.065	6z99B.pdb.gz	Acquisition of ionic copper by the bacterial outer membrane protein OprC through a novel binding site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q803G5	0.0	838	469	0.840	0.840	SAM5A_DANRE Sorting and assembly machinery component 50 homolog A OS=Danio rerio OX=7955 GN=samm50a PE=2 SV=1
2	Q8BGH2	0.0	932	469	0.959	0.959	SAM50_MOUSE Sorting and assembly machinery component 50 homolog OS=Mus musculus OX=10090 GN=Samm50 PE=1 SV=1
3	Q9Y512	0.0	965	469	1.000	1.000	SAM50_HUMAN Sorting and assembly machinery component 50 homolog OS=Homo sapiens OX=9606 GN=SAMM50 PE=1 SV=3
4	Q10478	1.05e-44	164	475	0.279	0.276	SAM50_SCHPO SAM50-like protein SPAC17C9.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17C9.06 PE=3 SV=1
5	Q9SRL6	1.52e-35	140	520	0.284	0.256	Q9SRL6_ARATH Outer membrane OMP85 family protein OS=Arabidopsis thaliana OX=3702 GN=F9F8.12 PE=1 SV=1
6	A0A1D8PKC1	7.00e-32	129	507	0.230	0.213	A0A1D8PKC1_CANAL SAM complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAM50 PE=4 SV=1
7	Q9FFG3	3.84e-31	127	524	0.269	0.240	Q9FFG3_ARATH Outer membrane OMP85 family protein OS=Arabidopsis thaliana OX=3702 GN=MOP10.6 PE=1 SV=1
8	P53969	1.03e-24	108	484	0.168	0.163	SAM50_YEAST Sorting assembly machinery 50 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAM50 PE=1 SV=1
9	Q580K4	8.06e-11	66.2	479	0.264	0.259	Q580K4_TRYB2 Bacterial surface antigen (D15) domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.640 PE=4 SV=1
10	P0A940	3.88e-10	64.7	810	0.217	0.126	BAMA_ECOLI Outer membrane protein assembly factor BamA OS=Escherichia coli (strain K12) OX=83333 GN=bamA PE=1 SV=1
11	Q55DS3	5.78e-04	44.7	396	0.203	0.240	Q55DS3_DICDI Bacterial surface antigen (D15) domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269550 PE=4 SV=1
12	A0A1D8PN01	0.006	41.2	508	0.100	0.093	A0A1D8PN01_CANAL Sam51p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAM51 PE=4 SV=1
13	Q5IZC8	0.73	34.7	396	0.043	0.051	TC754_ARATH Protein TOC75-4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC75-4 PE=2 SV=1
14	P39655	2.2	33.1	663	0.038	0.027	LOX12_MOUSE Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Mus musculus OX=10090 GN=Alox12 PE=1 SV=4
15	F1LQ70	3.0	32.7	663	0.038	0.027	LOX12_RAT Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Rattus norvegicus OX=10116 GN=Alox12 PE=1 SV=1
16	Q43715	3.3	32.7	809	0.045	0.026	TOC75_PEA Protein TOC75, chloroplastic OS=Pisum sativum OX=3888 GN=TOC75 PE=1 SV=1
17	Q9STE8	4.8	32.3	818	0.036	0.021	TC753_ARATH Protein TOC75-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC75-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01103 Omp85	7.5e-61	218.0	Omp85 superfamily domain
2	PF07244 POTRA	7.8	18.5	Surface antigen variable number repeat
3	PF01289 Thiol_cytolysin	4.6e+02	10.9	Thiol-activated cytolysin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345445

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387262	0.999	MICOS complex subunit MIC60
2	9606.ENSP00000410339	0.999	Mitochondrial import receptor subunit TOM40 homolog
3	9606.ENSP00000357360	0.998	Metaxin-1
4	9606.ENSP00000216034	0.992	Mitochondrial import receptor subunit TOM22 homolog
5	9606.ENSP00000249442	0.988	Metaxin-2
6	9606.ENSP00000262570	0.986	MICOS complex subunit MIC19
7	9606.ENSP00000325562	0.985	MICOS complex subunit MIC10
8	9606.ENSP00000265333	0.982	Voltage-dependent anion-selective channel protein 1
9	9606.ENSP00000423600	0.967	Metaxin-3
10	9606.ENSP00000290913	0.958	MICOS complex subunit MIC25
11	9606.ENSP00000284320	0.955	Mitochondrial import receptor subunit TOM70
12	9606.ENSP00000351214	0.945	Mitochondrial import receptor subunit TOM7 homolog
13	9606.ENSP00000355566	0.944	Mitochondrial import receptor subunit TOM20 homolog
14	9606.ENSP00000362268	0.917	MICOS complex subunit MIC27
15	9606.ENSP00000263774	0.892	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
16	9606.ENSP00000366800	0.888	DnaJ homolog subfamily C member 11
17	9606.ENSP00000309561	0.883	MICOS complex subunit MIC13
18	9606.ENSP00000215570	0.875	Mitochondrial import inner membrane translocase subunit Tim13
19	9606.ENSP00000356967	0.872	Mitochondrial import receptor subunit TOM40B
20	9606.ENSP00000297185	0.868	Stress-70 protein, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007006	0.989	mitochondrial membrane organization
GO:0006839	0.986	mitochondrial transport
GO:0071705	0.985	nitrogen compound transport
GO:0071702	0.985	organic substance transport
GO:0072655	0.985	establishment of protein localization to mitochondrion
GO:0006626	0.984	protein targeting to mitochondrion
GO:0051205	0.971	protein insertion into membrane
GO:0090151	0.970	establishment of protein localization to mitochondrial membrane
GO:0043933	0.967	protein-containing complex organization
GO:0007007	0.951	inner mitochondrial membrane organization
GO:0044085	0.948	cellular component biogenesis
GO:0051204	0.918	protein insertion into mitochondrial membrane
GO:0065003	0.915	protein-containing complex assembly
GO:0033108	0.913	mitochondrial respiratory chain complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.998	mitochondrial inner membrane
GO:0032991	0.986	protein-containing complex
GO:0098800	0.958	inner mitochondrial membrane protein complex
GO:0005576	0.950	extracellular region
GO:0098588	0.934	bounding membrane of organelle
GO:0070013	0.901	intracellular organelle lumen
GO:0031982	0.875	vesicle
GO:0005615	0.864	extracellular space
GO:0005741	0.848	mitochondrial outer membrane
GO:0070062	0.541	extracellular exosome
GO:0001401	0.479	SAM complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]