StarFunc result for job id Q9Y530

User Input

>input (152 residues)
MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLN
QQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRI
GCGLDRLQWENVSAMIEEVFEATDIKITVYTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RCY9	0.941	0.941	4.262E-30	152	1.000	1.000	A0A024RCY9.pdb.gz
2	PDB:2lgrA	0.889	0.889	2.003E-25	152	0.993	0.993	2lgrA.pdb.gz
3	AFDB:O53605	0.793	0.361	3.592E-9	352	0.230	0.099	O53605.pdb.gz	DARG_MYCTU DNA ADP-ribosyl glycohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=darG PE=1 SV=1
4	PDB:6lfqA	0.782	0.710	4.099E-9	169	0.263	0.237	6lfqA.pdb.gz
5	AFDB:P38218	0.768	0.669	5.508E-9	177	0.263	0.226	P38218.pdb.gz	POA1_YEAST ADP-ribose 1''-phosphate phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POA1 PE=1 SV=1
6	AFDB:Q86WJ1	0.747	0.146	5.962E-8	897	0.184	0.031	Q86WJ1.pdb.gz	CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=3
7	AFDB:A0A494C1P7	0.751	0.165	1.402E-7	792	0.217	0.042	A0A494C1P7.pdb.gz	A0A494C1P7_HUMAN Chromodomain helicase DNA binding protein 1 like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=1
8	PDB:6y4zA	0.675	0.485	3.603E-6	221	0.132	0.090	6y4zA.pdb.gz
9	AFDB:A0A2R8YFN3	0.710	0.269	8.916E-6	453	0.118	0.040	A0A2R8YFN3.pdb.gz	A0A2R8YFN3_HUMAN Mono-ADP ribosylhydrolase 2 OS=Homo sapiens OX=9606 GN=MACROD2 PE=1 SV=1
10	AFDB:Q4V914	0.713	0.321	1.286E-5	367	0.164	0.068	Q4V914.pdb.gz	Q4V914_DANRE Core histone macro-H2A OS=Danio rerio OX=7955 GN=zgc:114051 PE=1 SV=1
11	AFDB:Q922B1	0.679	0.349	1.286E-5	323	0.158	0.074	Q922B1.pdb.gz	MACD1_MOUSE ADP-ribose glycohydrolase MACROD1 OS=Mus musculus OX=10090 GN=Macrod1 PE=1 SV=2
12	PDB:6fx7A	0.691	0.558	1.299E-5	194	0.178	0.139	6fx7A.pdb.gz	Crystal structure of in vitro evolved Af1521
13	AFDB:P9WK29	0.736	0.336	1.855E-5	359	0.132	0.056	P9WK29.pdb.gz	Y1899_MYCTU Uncharacterized protein Rv1899c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1899c PE=1 SV=1
14	AFDB:A0A024QZP6	0.677	0.308	1.972E-5	372	0.138	0.056	A0A024QZP6.pdb.gz
15	PDB:5cb5R	0.700	0.625	2.117E-5	173	0.151	0.133	5cb5R.pdb.gz	Structural insights into the mechanism of Escherichia coli YmdB: A 2'-O-acetyl-ADP-ribose deacetylase
16	PDB:7epuB	0.651	0.159	4.145E-5	748	0.217	0.044	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
17	PDB:4ksiA	0.549	0.199	1.347E-3	517	0.138	0.041	4ksiA.pdb.gz	Structure of tomato wound-induced leucine aminopeptidase sheds light on substrate specificity.
18	PDB:2ewbA	0.506	0.195	4.375E-2	486	0.118	0.037	2ewbA.pdb.gz	Metal Ion Substitution in the Catalytic Site Greatly Affects the Binding of Sulfhydryl-Containing Compounds to Leucyl Aminopeptidase.
19	PDB:2hc9A	0.411	0.172	5.586E-2	489	0.072	0.022	2hc9A.pdb.gz	Crystal Structure and Function of Caenorhabditis Elegans Leucine Aminopeptidase
20	PDB:5szjA	0.214	0.196	1.396E-1	175	0.151	0.131	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y530	6.28e-113	318	152	1.000	1.000	OARD1_HUMAN ADP-ribose glycohydrolase OARD1 OS=Homo sapiens OX=9606 GN=OARD1 PE=1 SV=2
2	C9JNE2	5.74e-97	277	131	0.862	1.000	C9JNE2_HUMAN O-acyl-ADP-ribose deacylase 1 (Fragment) OS=Homo sapiens OX=9606 GN=OARD1 PE=1 SV=1
3	C9J5P1	1.82e-55	170	86	0.533	0.942	C9J5P1_HUMAN Chromosome 6 open reading frame 130, isoform CRA_a OS=Homo sapiens OX=9606 GN=OARD1 PE=1 SV=1
4	O53605	1.72e-04	42.7	352	0.270	0.116	DARG_MYCTU DNA ADP-ribosyl glycohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=darG PE=1 SV=1
5	Q584V4	1.3	31.6	736	0.125	0.026	Q584V4_TRYB2 FG-GAP repeat protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.130 PE=4 SV=1
6	A1ZB70	1.9	30.4	222	0.191	0.131	A1ZB70_DROME Glutathione S transferase E5 OS=Drosophila melanogaster OX=7227 GN=GstE5 PE=1 SV=1
7	Q5BI69	1.9	30.4	226	0.191	0.128	Q5BI69_DROME LP15255p (Fragment) OS=Drosophila melanogaster OX=7227 GN=GstE5 PE=2 SV=1
8	Q10332	2.8	30.4	830	0.132	0.024	YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC582.10c PE=1 SV=1
9	Q57VP8	3.2	30.0	741	0.158	0.032	Q57VP8_TRYB2 Malonyl-CoA decarboxylase, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.110 PE=4 SV=1
10	Q8CAS9	3.6	30.0	866	0.105	0.018	PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
11	Q2MF66	5.4	29.6	546	0.164	0.046	LIVQ_STRLV 6'''-hydroxyparomomycin C oxidase OS=Streptomyces lividus OX=282216 GN=livQ PE=1 SV=1
12	F1Q5F4	9.5	28.9	979	0.112	0.017	F1Q5F4_DANRE Chloride channel protein 2 OS=Danio rerio OX=7955 GN=clcn2a PE=2 SV=3
13	P38218	9.7	28.1	177	0.092	0.079	POA1_YEAST ADP-ribose 1''-phosphate phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02737 3HCDH_N	4e+02	12.3	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
2	PF01661 Macro	0.0024	29.3	Macro domain
3	PF13326 PSII_Pbs27	70	15.1	Photosystem II Pbs27

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010388051.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010364764.1	0.712	Ribonuclease H2 subunit C isoform X1
2	61622.XP_010375159.1	0.550	O-acetyl-ADP-ribose deacetylase MACROD1 isoform X1
3	61622.XP_010358720.1	0.540	ADP-ribosylhydrolase like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901363	1.000	heterocyclic compound binding
GO:0097367	1.000	carbohydrate derivative binding
GO:0097159	1.000	organic cyclic compound binding
GO:0036094	1.000	small molecule binding
GO:0005515	1.000	protein binding
GO:0061463	0.998	O-acetyl-ADP-ribose deacetylase activity
GO:0140293	0.998	ADP-ribosylglutamate hydrolase activity
GO:0001883	0.994	purine nucleoside binding
GO:0043167	0.325	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0036211	0.995	protein modification process
GO:0072521	0.994	purine-containing compound metabolic process
GO:0009116	0.988	nucleoside metabolic process
GO:0006974	0.977	cellular response to DNA damage stimulus
GO:0042278	0.963	purine nucleoside metabolic process
GO:0065007	0.641	biological regulation
GO:0050789	0.567	regulation of biological process
GO:0050794	0.364	regulation of cellular process
GO:0019222	0.336	regulation of metabolic process
GO:0051725	0.301	protein de-ADP-ribosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0005694	0.854	chromosome
GO:0005737	0.343	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.2.-	1.000	Hydrolyzing N-glycosyl compounds.

[back to server]