StarFunc result for job id Q9Y566

User Input

>input (2161 residues)
MTHSPATSEDEERHSASECPEGGSESDSSPDGPGRGPRGTRGQGSGAPGSLASVRGLQGR
SMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLF
QPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGL
KKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHI
DFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELL
LFNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTALHICALYNKE
TCARILLYRGADKDVKNNNGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR
RGPPGTGLTVPPALLRANSDTSMALPDWMVFSAPGAASSGAPGPTSGSQGQSQPSAPTTK
LSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGS
LGSRGRRRKLYSAVPGRSFMAVKSYQAQAEGEISLSKGEKIKVLSIGEGGFWEGQVKGRV
GWFPSDCLEEVANRSQESKQESRSDKAKRLFRHYTVGSYDSFDAPSLMDGIGPGSDYIIK
EKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGD
FLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKAPQQAKRLPPP
TISLRSKSMTSELEEMEYEQQPAPVPSMEKKRTVYQMALNKLDEILAAAQQTISASESPG
PGGLASLGKHRPKGFFATESSFDPHHRAQPSYERPSFLPPGPGLMLRQKSIGAAEDDRPY
LAPPAMKFSRSLSVPGSEDIPPPPTTSPPEPPYSTPPVPSSSGRLTPSPRGGPFNPGSGG
PLPASSPASFDGPSPPDTRVGSREKSLYHSGPLPPAHHHPPHHHHHHAPPPQPHHHHAHP
PHPPEMETGGSPDDPPPRLALGPQPSLRGWRGGGPSPTPGAPSPSHHGSAGGGGGSSQGP
ALRYFQLPPRAASAAMYVPARSGRGRKGPLVKQTKVEGEPQKGGGLPPAPSPTSPASPQP
PPAVAAPSEKNSIPIPTIIIKAPSTSSSGRSSQGSSTEAEPPTQPEPTGGGGGGGSSPSP
APAMSPVPPSPSPVPTPASPSGPATLDFTSQFGAALVGAARREGGWQNEARRRSTLFLST
DAGDEDGGDGGLGTGAAPGPRLRHSKSIDEGMFSAEPYLRLESAGSGAGYGGYGAGSRAY
GGGGGSSAFTSFLPPRPLVHPLTGKALDPASPLGLALAARERALKESSEGGGAPQPPPRP
PSPRYEAPPPTPHHHSPHAHHEPVLRLWGASPPDPARRELGYRAGLGSQEKSLPASPPAA
RRSLLHRLPPTAPGVGPLLLQLGTEPPAPHPGVSKPWRSAAPEEPERLPLHVRFLENCQP
RAPVTSGRGPPSEDGPGVPPPSPRRSVPPSPTSPRASEENGLPLLVLPPPAPSVDVEDGE
FLFVEPLPPPLEFSNSFEKPESPLTPGPPHPLPDTPAPATPLPPVPPPAVAAAPPTLDST
ASSLTSYDSEVATLTQGASAAPGDPHPPGPPAPAAPAPAAPQPGPDPPPGTDSGIEEVDS
RSSSDHPLETISSASTLSSLSAEGGGSAGGGGGAGAGVASGPELLDTYVAYLDGQAFGGS
STPGPPYPPQLMTPSKLRGRALGASGGLRPGPSGGLRDPVTPTSPTVSVTGAGTDGLLAL
RACSGPPTAGVAGGPVAVEPEVPPVPLPTASSLPRKLLPWEEGPGPPPPPLPGPLAQPQA
SALATVKASIISELSSKLQQFGGSSAAGGALPWARGGSGGGGDSHHGGASYVPERTSSLQ
RQRLSDDSQSSLLSKPVSSLFQNWPKPPLPPLPTGTGVSPTAAAAPGATSPSASSSSTST
RHLQGVEFEMRPPLLRRAPSPSLLPASEHKVSPAPRPSSLPILPSGPLYPGLFDIRGSPT
GGAGGSADPFAPVFVPPHPGISGGLGGALSGASRSLSPTRLLSLPPDKPFGAKPLGFWTK
FDVADWLEWLGLAEHRAQFLDHEIDGSHLPALTKEDYVDLGVTRVGHRMNIDRALKFFLE
R

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3YZU1	0.216	0.216	0.000	2167	0.937	0.934	D3YZU1.pdb.gz	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
2	AFDB:Q9JLU4	0.176	0.213	9.575E-101	1740	0.362	0.450	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
3	AFDB:F1R0Q7	0.202	0.261	2.689E-96	1631	0.337	0.446	F1R0Q7.pdb.gz
4	AFDB:F1QJ05	0.117	0.165	1.859E-73	1509	0.288	0.412	F1QJ05.pdb.gz
5	AFDB:A1Z9K8	0.165	0.190	3.948E-61	1871	0.223	0.258	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
6	AFDB:Q80Z38	0.080	0.106	2.171E-57	1476	0.285	0.417	Q80Z38.pdb.gz	SHAN2_MOUSE SH3 and multiple ankyrin repeat domains protein 2 OS=Mus musculus OX=10090 GN=Shank2 PE=1 SV=2
7	AFDB:Q9UPX8	0.074	0.102	5.432E-57	1470	0.276	0.405	Q9UPX8.pdb.gz	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
8	AFDB:O70511	0.092	0.077	4.089E-16	2622	0.154	0.127	O70511.pdb.gz	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
9	AFDB:Q8WXD9	0.099	0.141	5.552E-16	1431	0.134	0.203	Q8WXD9.pdb.gz	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
10	AFDB:F1QBX1	0.041	0.071	9.155E-15	1170	0.166	0.306	F1QBX1.pdb.gz
11	PDB:8cs9A	0.100	0.267	3.380E-13	796	0.030	0.080	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.098	0.858	1.138E-11	229	0.030	0.279	2dvwA.pdb.gz
13	PDB:4oauC	0.096	0.284	3.458E-10	692	0.028	0.088	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:5vkqA	0.089	0.124	2.165E-9	1499	0.031	0.044	5vkqA.pdb.gz
15	PDB:1wg0A	0.097	0.761	4.847E-8	243	0.022	0.193	1wg0A.pdb.gz
16	PDB:6jd6B	0.067	0.554	6.581E-8	192	0.020	0.229	6jd6B.pdb.gz
17	PDB:6v9hC	0.096	0.708	8.935E-8	270	0.023	0.185	6v9hC.pdb.gz
18	PDB:6aunA	0.086	0.252	1.041E-7	618	0.023	0.079	6aunA.pdb.gz
19	PDB:6mwqA	0.068	0.291	2.353E-7	493	0.024	0.103	6mwqA.pdb.gz
20	PDB:1bd8A	0.068	0.880	9.801E-7	156	0.015	0.212	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YZU1	0.0	3289	2167	0.938	0.935	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
2	H9KV90	0.0	4240	2169	1.000	0.996	H9KV90_HUMAN SH3 and multiple ankyrin repeat domains 1 OS=Homo sapiens OX=9606 GN=SHANK1 PE=1 SV=1
3	Q9UPX8	0.0	1057	1849	0.357	0.417	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
4	Q9WV48	0.0	3261	2167	0.935	0.932	SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus OX=10116 GN=Shank1 PE=1 SV=1
5	Q9Y566	0.0	4247	2161	1.000	1.000	SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens OX=9606 GN=SHANK1 PE=1 SV=2
6	Q9BYB0	6.64e-161	544	1731	0.114	0.142	SHAN3_HUMAN SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens OX=9606 GN=SHANK3 PE=1 SV=3
7	Q4ACU6	2.23e-159	540	1730	0.116	0.145	SHAN3_MOUSE SH3 and multiple ankyrin repeat domains protein 3 OS=Mus musculus OX=10090 GN=Shank3 PE=1 SV=3
8	Q9JLU4	2.99e-159	540	1740	0.116	0.144	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
9	Q80Z38	5.16e-123	428	1476	0.126	0.185	SHAN2_MOUSE SH3 and multiple ankyrin repeat domains protein 2 OS=Mus musculus OX=10090 GN=Shank2 PE=1 SV=2
10	Q9QX74	1.03e-120	421	1474	0.126	0.185	SHAN2_RAT SH3 and multiple ankyrin repeat domains protein 2 OS=Rattus norvegicus OX=10116 GN=Shank2 PE=1 SV=2
11	A1Z9K8	1.25e-103	373	1871	0.080	0.092	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
12	A0A0B4LFA9	1.29e-99	359	1725	0.076	0.095	A0A0B4LFA9_DROME Prosap, isoform C OS=Drosophila melanogaster OX=7227 GN=Prosap PE=4 SV=1
13	B7WN72	1.90e-89	321	1140	0.076	0.144	SHANK_CAEEL Protein shank OS=Caenorhabditis elegans OX=6239 GN=shn-1 PE=1 SV=1
14	A0A0B4LF25	3.79e-63	241	1660	0.055	0.071	A0A0B4LF25_DROME Prosap, isoform E OS=Drosophila melanogaster OX=7227 GN=Prosap PE=4 SV=1
15	A0A0B4K7Z0	4.66e-63	241	1806	0.055	0.065	A0A0B4K7Z0_DROME Prosap, isoform D OS=Drosophila melanogaster OX=7227 GN=Prosap PE=4 SV=1
16	Q961U4	6.64e-21	103	1478	0.025	0.037	Q961U4_DROME GH06265p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=1
17	Q8C8R3	2.94e-20	101	3898	0.032	0.018	ANK2_MOUSE Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2
18	X2JCM1	6.45e-20	100	11634	0.032	0.006	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	M9MRX4	1.27e-19	99.8	13559	0.032	0.005	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	Q17490	4.06e-18	94.7	6994	0.033	0.010	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	4.6e-09	47.5	Ankyrin repeat
2	PF12796 Ank_2	1.8e-31	119.8	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.3e-07	41.4	Ankyrin repeat
4	PF13637 Ank_4	2.2e-17	74.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3e-11	54.6	Ankyrin repeats (many copies)
6	PF16511 FERM_f0	0.16	23.6	N-terminal or F0 domain of Talin-head FERM
7	PF00595 PDZ	2e-05	36.2	PDZ domain
8	PF17820 PDZ_6	4.8e-06	37.7	PDZ domain
9	PF02163 Peptidase_M50	21	15.8	Peptidase family M50
10	PF00536 SAM_1	2.4e-15	68.0	SAM domain (Sterile alpha motif)
11	PF07647 SAM_2	1.8e-07	42.5	SAM domain (Sterile alpha motif)
12	PF02198 SAM_PNT	13	17.2	Sterile alpha motif (SAM)/Pointed domain
13	PF00018 SH3_1	1.1e-05	36.2	SH3 domain
14	PF07653 SH3_2	1.5e-09	48.8	Variant SH3 domain
15	PF14604 SH3_9	0.00064	30.9	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293441

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316377	0.996	Disks large-associated protein 1
2	9606.ENSP00000334382	0.995	Homer protein homolog 1
3	9606.ENSP00000382428	0.988	Disks large homolog 4
4	9606.ENSP00000362444	0.975	Disks large-associated protein 3
5	9606.ENSP00000381698	0.961	Sharpin
6	9606.ENSP00000305632	0.952	Homer protein homolog 2
7	9606.ENSP00000400258	0.952	Disks large-associated protein 2
8	9606.ENSP00000306138	0.931	Metabotropic glutamate receptor 5
9	9606.ENSP00000439937	0.926	Homer protein homolog 3
10	9606.ENSP00000365272	0.895	Disks large homolog 2
11	9606.ENSP00000351591	0.893	Neuroligin-3
12	9606.ENSP00000354896	0.890	Metabotropic glutamate receptor 1
13	9606.ENSP00000469689	0.881	SH3 and multiple ankyrin repeat domains protein 2
14	9606.ENSP00000265459	0.877	Neurexin-2
15	9606.ENSP00000385142	0.876	Neurexin-1
16	9606.ENSP00000363480	0.873	Disks large homolog 3
17	9606.ENSP00000370485	0.873	Neuroligin-4, X-linked
18	9606.ENSP00000316338	0.871	Brain-specific angiogenesis inhibitor 1-associated protein 2
19	9606.ENSP00000451648	0.848	Neurexin-3
20	9606.ENSP00000477455	0.827	Glutamate receptor ionotropic, NMDA 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0030159	0.981	signaling receptor complex adaptor activity
GO:0099186	0.978	structural constituent of postsynapse
GO:0035255	0.970	ionotropic glutamate receptor binding
GO:0098919	0.787	structural constituent of postsynaptic density
GO:0030160	0.559	synaptic receptor adaptor activity
GO:0042802	0.445	identical protein binding
GO:0097110	0.382	scaffold protein binding
GO:0019904	0.342	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0032501	0.987	multicellular organismal process
GO:0065007	0.985	biological regulation
GO:0050789	0.981	regulation of biological process
GO:0051703	0.954	biological process involved in intraspecies interaction between organisms
GO:0007610	0.948	behavior
GO:0035176	0.938	social behavior
GO:0050890	0.937	cognition
GO:0016043	0.930	cellular component organization
GO:0050794	0.924	regulation of cellular process
GO:0048518	0.879	positive regulation of biological process
GO:0032502	0.836	developmental process
GO:0048856	0.831	anatomical structure development
GO:0030534	0.779	adult behavior
GO:0050896	0.680	response to stimulus
GO:0048522	0.622	positive regulation of cellular process
GO:0007275	0.610	multicellular organism development
GO:0010646	0.556	regulation of cell communication
GO:0048731	0.538	system development
GO:0007399	0.503	nervous system development
GO:0023051	0.488	regulation of signaling
GO:0034330	0.436	cell junction organization
GO:0009966	0.354	regulation of signal transduction
GO:0051179	0.327	localization
GO:0050808	0.320	synapse organization
GO:0065008	0.304	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.998	cytoplasm
GO:0043226	0.991	organelle
GO:0005829	0.990	cytosol
GO:0030054	0.951	cell junction
GO:0045202	0.888	synapse
GO:0098590	0.724	plasma membrane region
GO:0043229	0.713	intracellular organelle
GO:0043005	0.697	neuron projection
GO:0098794	0.639	postsynapse
GO:0099572	0.570	postsynaptic specialization
GO:0032279	0.568	asymmetric synapse
GO:0014069	0.530	postsynaptic density
GO:0043227	0.529	membrane-bounded organelle
GO:0043231	0.524	intracellular membrane-bounded organelle
GO:0036477	0.483	somatodendritic compartment
GO:0097060	0.481	synaptic membrane
GO:0030425	0.438	dendrite
GO:0043232	0.422	intracellular non-membrane-bounded organelle
GO:0045211	0.417	postsynaptic membrane
GO:0044309	0.406	neuron spine
GO:0043197	0.401	dendritic spine
GO:0098978	0.354	glutamatergic synapse
GO:0060076	0.343	excitatory synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]