StarFunc result for job id Q9Y572

User Input

>input (518 residues)
MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISRE
VKAMASLDNEFVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRL
LKEVVLGMFYLHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPG
GTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYEAVCNRQNRP
SLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST
VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSS
VPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG
PRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLA
PSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y572	1.000	1.000	3.574E-86	518	1.000	1.000	Q9Y572.pdb.gz	RIPK3_HUMAN Receptor-interacting serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=RIPK3 PE=1 SV=2
2	AFDB:Q9QZL0	0.549	0.584	7.145E-47	486	0.562	0.599	Q9QZL0.pdb.gz	RIPK3_MOUSE Receptor-interacting serine/threonine-protein kinase 3 OS=Mus musculus OX=10090 GN=Ripk3 PE=1 SV=2
3	AFDB:F7BN18	0.426	0.205	5.840E-19	1128	0.218	0.100	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
4	AFDB:A0A024R8E2	0.428	0.206	8.110E-19	1130	0.230	0.105	A0A024R8E2.pdb.gz
5	AFDB:P42684	0.436	0.200	1.564E-18	1182	0.208	0.091	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
6	AFDB:E9PT20	0.428	0.203	3.556E-18	1143	0.218	0.099	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
7	AFDB:Q7ZVS3	0.429	0.243	7.653E-18	940	0.222	0.122	Q7ZVS3.pdb.gz	PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio OX=7955 GN=plk4 PE=2 SV=2
8	AFDB:P03949	0.439	0.197	9.019E-18	1224	0.207	0.087	P03949.pdb.gz	ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans OX=6239 GN=abl-1 PE=1 SV=4
9	AFDB:P00522	0.435	0.147	1.063E-17	1620	0.205	0.065	P00522.pdb.gz	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
10	AFDB:B4E0Y5	0.437	0.344	5.801E-17	672	0.203	0.156	B4E0Y5.pdb.gz	B4E0Y5_HUMAN cDNA FLJ56013, highly similar to NUAK family SNF1-like kinase 2 OS=Homo sapiens OX=9606 PE=2 SV=1
11	PDB:8dksA	0.398	0.703	7.967E-17	283	0.129	0.237	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
12	PDB:5u6yA	0.401	0.448	2.657E-16	459	0.141	0.159	5u6yA.pdb.gz
13	PDB:4zhxA	0.423	0.528	5.413E-16	409	0.131	0.166	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:2qkwB	0.427	0.725	7.941E-16	292	0.143	0.253	2qkwB.pdb.gz
15	PDB:4eomC	0.428	0.769	8.388E-16	276	0.143	0.268	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:6b1uA	0.406	0.471	1.230E-15	442	0.143	0.167	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:1k9aB	0.420	0.490	1.618E-15	441	0.149	0.175	1k9aB.pdb.gz
18	PDB:4krcA	0.425	0.722	1.907E-15	297	0.151	0.263	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
19	PDB:6pjxA	0.407	0.390	2.373E-15	543	0.151	0.144	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
20	PDB:6lk5A	0.426	0.797	3.482E-15	265	0.118	0.230	6lk5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y572	0.0	1062	518	1.000	1.000	RIPK3_HUMAN Receptor-interacting serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=RIPK3 PE=1 SV=2
2	Q9QZL0	4.25e-177	509	486	0.573	0.611	RIPK3_MOUSE Receptor-interacting serine/threonine-protein kinase 3 OS=Mus musculus OX=10090 GN=Ripk3 PE=1 SV=2
3	Q4V958	7.26e-45	168	584	0.226	0.200	Q4V958_DANRE Receptor-interacting serine/threonine-protein kinase 2 OS=Danio rerio OX=7955 GN=RICK PE=2 SV=1
4	A0A060WPC3	1.08e-44	168	589	0.220	0.194	A0A060WPC3_ONCMY Receptor-interacting serine/threonine-protein kinase 2 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00058388001 PE=4 SV=1
5	D3ZYL0	3.90e-41	159	658	0.183	0.144	D3ZYL0_RAT Receptor interacting serine/threonine kinase 1 OS=Rattus norvegicus OX=10116 GN=Ripk1 PE=1 SV=1
6	Q60855	4.02e-41	159	656	0.189	0.149	RIPK1_MOUSE Receptor-interacting serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Ripk1 PE=1 SV=1
7	Q9ERK0	3.64e-39	154	786	0.193	0.127	RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2
8	Q9H4D1	4.41e-39	154	784	0.193	0.128	Q9H4D1_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=dik PE=2 SV=1
9	P58801	4.85e-39	151	539	0.201	0.193	RIPK2_MOUSE Receptor-interacting serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Ripk2 PE=1 SV=1
10	Q13546	2.82e-38	150	671	0.189	0.146	RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=RIPK1 PE=1 SV=3
11	P57078	1.91e-37	149	832	0.189	0.118	RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1
12	A0A0S2Z4Z8	7.10e-36	142	540	0.185	0.178	A0A0S2Z4Z8_HUMAN Receptor-interacting serine-threonine kinase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RIPK2 PE=2 SV=1
13	O43353	7.10e-36	142	540	0.185	0.178	RIPK2_HUMAN Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=RIPK2 PE=1 SV=2
14	Q8BZ25	7.27e-35	141	745	0.180	0.125	ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankk1 PE=2 SV=1
15	Q0MSH9	1.48e-34	140	661	0.185	0.145	Q0MSH9_DANRE Receptor-interacting protein 1 OS=Danio rerio OX=7955 GN=rip1 PE=2 SV=1
16	Q8NFD2	4.10e-34	139	765	0.174	0.118	ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1
17	Q54RB7	1.62e-32	132	527	0.181	0.178	SHKA_DICDI Dual specificity protein kinase shkA OS=Dictyostelium discoideum OX=44689 GN=shkA PE=2 SV=1
18	Q9M020	1.75e-29	125	688	0.178	0.134	LRK63_ARATH Lectin-domain containing receptor kinase VI.3 OS=Arabidopsis thaliana OX=3702 GN=LECRK63 PE=2 SV=1
19	Q54TM7	5.08e-29	124	1288	0.172	0.069	DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum OX=44689 GN=drkD PE=2 SV=1
20	Q9M3D7	3.64e-28	120	667	0.183	0.142	LRK14_ARATH Putative L-type lectin-domain containing receptor kinase I.4 OS=Arabidopsis thaliana OX=3702 GN=LECRK14 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	12	16.5	ABC1 atypical kinase-like domain
2	PF01636 APH	8.2	17.8	Phosphotransferase enzyme family
3	PF00069 Pkinase	4.9e-38	142.6	Protein kinase domain
4	PF17667 Pkinase_fungal	5.9e+02	10.6	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	3.5e-37	139.7	Protein tyrosine and serine/threonine kinase
6	PF12721 RHIM	2e-05	35.0	RIP homotypic interaction motif
7	PF07424 TrbM	4.3e+02	12.3	TrbM

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216274

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301838	0.999	FAS-associated death domain protein
2	9606.ENSP00000351273	0.999	Caspase-8
3	9606.ENSP00000259808	0.997	Receptor-interacting serine/threonine-protein kinase 1
4	9606.ENSP00000341268	0.992	Tumor necrosis factor receptor type 1-associated DEATH domain protein
5	9606.ENSP00000360215	0.991	Z-DNA-binding protein 1
6	9606.ENSP00000308351	0.989	Mixed lineage kinase domain-like protein
7	9606.ENSP00000312455	0.986	CASP8 and FADD-like apoptosis regulator
8	9606.ENSP00000477613	0.976	Baculoviral IAP repeat-containing protein 2
9	9606.ENSP00000263464	0.968	Baculoviral IAP repeat-containing protein 3
10	9606.ENSP00000360242	0.966	E3 ubiquitin-protein ligase XIAP
11	9606.ENSP00000247668	0.961	TNF receptor-associated factor 2
12	9606.ENSP00000483825	0.952	NF-kappa-B essential modulator
13	9606.ENSP00000241261	0.950	Tumor necrosis factor ligand superfamily member 10
14	9606.ENSP00000356694	0.949	Tumor necrosis factor ligand superfamily member 6
15	9606.ENSP00000347979	0.947	Tumor necrosis factor receptor superfamily member 6
16	9606.ENSP00000248244	0.938	TIR domain-containing adapter molecule 1
17	9606.ENSP00000221132	0.937	Tumor necrosis factor receptor superfamily member 10A
18	9606.ENSP00000276431	0.930	Tumor necrosis factor receptor superfamily member 10B
19	9606.ENSP00000249396	0.921	NAD-dependent protein deacetylase sirtuin-2
20	9606.ENSP00000359424	0.915	Inhibitor of nuclear factor kappa-B kinase subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0042802	0.992	identical protein binding
GO:0003712	0.816	transcription coregulator activity
GO:0044877	0.620	protein-containing complex binding
GO:0003713	0.584	transcription coactivator activity
GO:0019899	0.424	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0048518	0.988	positive regulation of biological process
GO:0048522	0.984	positive regulation of cellular process
GO:0051716	0.974	cellular response to stimulus
GO:0008152	0.973	metabolic process
GO:0007154	0.971	cell communication
GO:0009893	0.971	positive regulation of metabolic process
GO:0065009	0.970	regulation of molecular function
GO:0023052	0.967	signaling
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0008219	0.960	cell death
GO:0051171	0.959	regulation of nitrogen compound metabolic process
GO:0044093	0.953	positive regulation of molecular function
GO:0080090	0.948	regulation of primary metabolic process
GO:0010604	0.946	positive regulation of macromolecule metabolic process
GO:0071704	0.945	organic substance metabolic process
GO:0044237	0.939	cellular metabolic process
GO:0010939	0.936	regulation of necrotic cell death
GO:0070265	0.919	necrotic cell death
GO:0043085	0.916	positive regulation of catalytic activity
GO:0007165	0.906	signal transduction
GO:0012501	0.904	programmed cell death
GO:0044238	0.901	primary metabolic process
GO:0048583	0.872	regulation of response to stimulus
GO:0006807	0.867	nitrogen compound metabolic process
GO:0043170	0.862	macromolecule metabolic process
GO:0031325	0.852	positive regulation of cellular metabolic process
GO:0051090	0.847	regulation of DNA-binding transcription factor activity
GO:0010942	0.839	positive regulation of cell death
GO:0043068	0.827	positive regulation of programmed cell death
GO:0006915	0.825	apoptotic process
GO:1901564	0.807	organonitrogen compound metabolic process
GO:0010646	0.773	regulation of cell communication
GO:0051247	0.771	positive regulation of protein metabolic process
GO:0051092	0.771	positive regulation of NF-kappaB transcription factor activity
GO:0023051	0.767	regulation of signaling
GO:0048584	0.767	positive regulation of response to stimulus
GO:0051174	0.765	regulation of phosphorus metabolic process
GO:0051336	0.761	regulation of hydrolase activity
GO:0009966	0.760	regulation of signal transduction
GO:0042327	0.733	positive regulation of phosphorylation
GO:0031401	0.725	positive regulation of protein modification process
GO:0019538	0.719	protein metabolic process
GO:0042981	0.716	regulation of apoptotic process
GO:0001932	0.712	regulation of protein phosphorylation
GO:0001934	0.646	positive regulation of protein phosphorylation
GO:0043412	0.642	macromolecule modification
GO:0036211	0.621	protein modification process
GO:0016310	0.612	phosphorylation
GO:0006468	0.591	protein phosphorylation
GO:0045859	0.554	regulation of protein kinase activity
GO:0042221	0.553	response to chemical
GO:0051347	0.535	positive regulation of transferase activity
GO:0045860	0.525	positive regulation of protein kinase activity
GO:0006950	0.486	response to stress
GO:0048519	0.485	negative regulation of biological process
GO:0009967	0.482	positive regulation of signal transduction
GO:1902531	0.476	regulation of intracellular signal transduction
GO:0007166	0.453	cell surface receptor signaling pathway
GO:1902533	0.443	positive regulation of intracellular signal transduction
GO:0010033	0.435	response to organic substance
GO:0035556	0.424	intracellular signal transduction
GO:0009605	0.422	response to external stimulus
GO:0071840	0.421	cellular component organization or biogenesis
GO:0048523	0.408	negative regulation of cellular process
GO:0051239	0.391	regulation of multicellular organismal process
GO:0002682	0.385	regulation of immune system process
GO:0051707	0.385	response to other organism
GO:0002376	0.380	immune system process
GO:0070887	0.380	cellular response to chemical stimulus
GO:0016043	0.367	cellular component organization
GO:0080134	0.354	regulation of response to stress
GO:0006952	0.353	defense response
GO:0050776	0.320	regulation of immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.995	protein-containing complex
GO:0016020	0.937	membrane
GO:0043231	0.850	intracellular membrane-bounded organelle
GO:0071944	0.762	cell periphery
GO:0005886	0.670	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]