StarFunc result for job id Q9Y5A7

User Input

>input (615 residues)
MAQKKYLQAKLTQFLREDRIQLWKPPYTDENKKVGLALKDLAKQYSDRLECCENEVEKVI
EEIRCKAIERGTGNDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETF
GLQENYIKIVINKKQLQLGKTLEEQGVAHNVKAMVLELKQSEEDARKNFQLEEEEQNEAK
LKEKQIQRTKRGLEILAKRAAETVVDPEMTPYLDIANQTGRSIRIPPSERKALMLAMGYH
EKGRAFLKRKEYGIALPCLLDADKYFCECCRELLDTVDNYAVLQLDIVWCYFRLEQLECL
DDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRNYHSGNDVEAY
EYLNKARQLFKELYIDPSKVDNLLQLGFTAQEARLGLRACDGNVDHAATHITNRREELAQ
IRKEEKEKKRRRLENIRFLKGMGYSTHAAQQVLHAASGNLDEALKILLSNPQMWWLNDSN
PETDNRQESPSQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLS
PEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAE
YLSYVENRKSATKKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H3BM74	0.871	0.839	1.344E-74	639	1.000	0.962	H3BM74.pdb.gz	H3BM74_HUMAN NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1 PE=1 SV=1
2	AFDB:P54729	0.967	0.968	2.671E-72	614	0.865	0.866	P54729.pdb.gz	NUB1_MOUSE NEDD8 ultimate buster 1 OS=Mus musculus OX=10090 GN=Nub1 PE=1 SV=2
3	AFDB:A0A140VK64	0.122	0.172	3.390E-4	405	0.086	0.131	A0A140VK64.pdb.gz	A0A140VK64_HUMAN Ubiquitin-associated domain-containing protein 1 OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:Q9SU29	0.128	0.100	2.545E-3	873	0.096	0.068	Q9SU29.pdb.gz	UPL5_ARATH E3 ubiquitin-protein ligase UPL5 OS=Arabidopsis thaliana OX=3702 GN=UPL5 PE=1 SV=1
5	AFDB:P9WNQ1	0.117	0.152	4.778E-3	467	0.094	0.124	P9WNQ1.pdb.gz	ECCD4_MYCTU ESX-4 secretion system protein eccD4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=eccD4 PE=3 SV=1
6	AFDB:A0A0B4KFW5	0.120	0.130	6.147E-3	561	0.120	0.132	A0A0B4KFW5.pdb.gz	A0A0B4KFW5_DROME Isopeptidase-T-3, isoform C OS=Drosophila melanogaster OX=7227 GN=Kpc2 PE=4 SV=1
7	PDB:3ai5A	0.115	0.233	6.353E-3	299	0.026	0.054	3ai5A.pdb.gz
8	AFDB:Q0WUQ1	0.120	0.209	7.583E-3	342	0.046	0.082	Q0WUQ1.pdb.gz	BAG1_ARATH BAG family molecular chaperone regulator 1 OS=Arabidopsis thaliana OX=3702 GN=BAG1 PE=1 SV=1
9	PDB:7rbsB	0.116	0.422	8.174E-3	157	0.028	0.108	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
10	AFDB:O60125	0.117	0.353	8.248E-3	195	0.049	0.154	O60125.pdb.gz	BAG1A_SCHPO BAG family molecular chaperone regulator 1A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bag101 PE=2 SV=1
11	PDB:6yvaC	0.117	0.440	9.272E-3	155	0.028	0.110	6yvaC.pdb.gz
12	AFDB:Q7KTX7	0.123	0.155	9.355E-3	482	0.029	0.037	Q7KTX7.pdb.gz	PRKN_DROME E3 ubiquitin-protein ligase parkin OS=Drosophila melanogaster OX=7227 GN=park PE=1 SV=1
13	AFDB:P05161	0.119	0.410	1.017E-2	165	0.029	0.109	P05161.pdb.gz	ISG15_HUMAN Ubiquitin-like protein ISG15 OS=Homo sapiens OX=9606 GN=ISG15 PE=1 SV=5
14	PDB:6mdhA	0.109	0.426	1.297E-2	149	0.023	0.094	6mdhA.pdb.gz
15	PDB:3dbhI	0.118	0.738	2.881E-2	86	0.015	0.105	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
16	PDB:3plvA	0.116	0.816	3.134E-2	80	0.021	0.163	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
17	PDB:4pyuA	0.112	0.822	3.408E-2	76	0.018	0.145	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
18	PDB:3pgeA	0.113	0.364	3.707E-2	172	0.016	0.058	3pgeA.pdb.gz
19	PDB:5xqmA	0.110	0.639	4.573E-2	90	0.013	0.089	5xqmA.pdb.gz
20	PDB:3tixA	0.116	0.420	4.974E-2	153	0.041	0.163	3tixA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A090N8Q5	0.0	1229	601	0.977	1.000	A0A090N8Q5_HUMAN NEDD8 ultimate buster-1 OS=Homo sapiens OX=9606 GN=NYREN18 PE=4 SV=1
2	C9JRT6	0.0	515	254	0.413	1.000	C9JRT6_HUMAN Negative regulator of ubiquitin like proteins 1 (Fragment) OS=Homo sapiens OX=9606 GN=NUB1 PE=1 SV=1
3	H3BM14	0.0	1226	625	0.977	0.962	H3BM14_HUMAN NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1 PE=1 SV=1
4	H3BM74	0.0	1264	639	1.000	0.962	H3BM74_HUMAN NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1 PE=1 SV=1
5	P54729	0.0	1002	614	0.867	0.868	NUB1_MOUSE NEDD8 ultimate buster 1 OS=Mus musculus OX=10090 GN=Nub1 PE=1 SV=2
6	Q9Y5A7	0.0	1266	615	1.000	1.000	NUB1_HUMAN NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1 PE=1 SV=2
7	P54201	0.27	37.0	837	0.029	0.022	UBPA_DICDI Ubiquitin carboxyl-terminal hydrolase A OS=Dictyostelium discoideum OX=44689 GN=ubpA PE=2 SV=2
8	Q57WB0	2.0	33.9	621	0.026	0.026	Q57WB0_TRYB2 C2H2-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.810 PE=4 SV=1
9	P38349	3.4	33.1	436	0.041	0.057	UBX7_YEAST UBX domain-containing protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBX7 PE=1 SV=1
10	Q10209	4.5	32.7	392	0.076	0.120	YAY1_SCHPO Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.01 PE=1 SV=1
11	Q6P158	4.6	32.7	1386	0.028	0.012	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
12	Q11119	4.7	32.7	775	0.042	0.034	UBP14_SCHPO Ubiquitin carboxyl-terminal hydrolase 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp14 PE=1 SV=2
13	Q12386	6.4	32.3	881	0.042	0.030	ARP8_YEAST Actin-like protein ARP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP8 PE=1 SV=1
14	Q9VZU7	7.7	32.0	827	0.034	0.025	Q9VZU7_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp5 PE=1 SV=1
15	Q10SY2	8.3	30.0	106	0.021	0.123	EL2_ORYSJ Cyclin-dependent protein kinase inhibitor EL2 OS=Oryza sativa subsp. japonica OX=39947 GN=EL2 PE=1 SV=1
16	Q5XPJ6	8.4	32.0	1170	0.052	0.027	SCAR4_ARATH Protein SCAR4 OS=Arabidopsis thaliana OX=3702 GN=SCAR4 PE=1 SV=1
17	Q6ZQA0	8.5	32.0	2742	0.029	0.007	NBEL2_MOUSE Neurobeachin-like protein 2 OS=Mus musculus OX=10090 GN=Nbeal2 PE=1 SV=2
18	Q9LTQ0	9.5	31.6	391	0.068	0.107	RTL2_ARATH Ribonuclease 3-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=RTL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04464 Glyphos_transf	3.3e+02	11.6	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase
2	PF16678 HOIP-UBA	58	15.0	HOIP UBA domain pair
3	PF02954 HTH_8	1.4e+02	13.7	Bacterial regulatory protein, Fis family
4	PF19026 HYPK_UBA	2.6e+02	12.4	HYPK UBA domain
5	PF07499 RuvA_C	4.7e+02	12.6	RuvA, C-terminal domain
6	PF13424 TPR_12	5.1e+02	12.4	Tetratricopeptide repeat
7	PF00627 UBA	1.1e-17	74.8	UBA/TS-N domain
8	PF14555 UBA_4	2.6e+02	12.9	UBA-like domain
9	PF18037 Ubiquitin_5	2.6e-35	132.0	Ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000454264

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000250495	0.996	NEDD8
2	9606.ENSP00000366249	0.995	Ubiquitin D
3	9606.ENSP00000357879	0.994	26S proteasome non-ATPase regulatory subunit 4
4	9606.ENSP00000370521	0.992	Aryl-hydrocarbon-interacting protein-like 1
5	9606.ENSP00000310129	0.749	26S proteasome non-ATPase regulatory subunit 2
6	9606.ENSP00000261368	0.718	Synphilin-1
7	9606.ENSP00000290541	0.695	Proteasome subunit beta type-4
8	9606.ENSP00000481021	0.695	Putative protein SEM1, isoform 2
9	9606.ENSP00000351314	0.669	Proteasome subunit beta type-10
10	9606.ENSP00000157812	0.653	26S proteasome regulatory subunit 6B
11	9606.ENSP00000478877	0.653	Proteasomal ubiquitin receptor ADRM1
12	9606.ENSP00000364016	0.650	Proteasome subunit beta type-8
13	9606.ENSP00000338039	0.647	Proteasome inhibitor PI31 subunit
14	9606.ENSP00000408910	0.642	Dynactin subunit 2
15	9606.ENSP00000216802	0.637	Proteasome activator complex subunit 2
16	9606.ENSP00000261712	0.634	26S proteasome non-ATPase regulatory subunit 11
17	9606.ENSP00000271308	0.629	Proteasome subunit alpha type-5
18	9606.ENSP00000396937	0.629	Proteasome 26S subunit, non-ATPase 13
19	9606.ENSP00000372155	0.627	Proteasome activator complex subunit 1
20	9606.ENSP00000216455	0.625	Proteasome subunit alpha type-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.369	organic cyclic compound binding
GO:1901363	0.351	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0050789	0.981	regulation of biological process
GO:0043632	0.979	modification-dependent macromolecule catabolic process
GO:0030162	0.973	regulation of proteolysis
GO:1901564	0.956	organonitrogen compound metabolic process
GO:0050794	0.946	regulation of cellular process
GO:0042176	0.944	regulation of protein catabolic process
GO:0048518	0.938	positive regulation of biological process
GO:1903050	0.933	regulation of proteolysis involved in protein catabolic process
GO:0031323	0.925	regulation of cellular metabolic process
GO:0019941	0.901	modification-dependent protein catabolic process
GO:0036211	0.878	protein modification process
GO:0061136	0.869	regulation of proteasomal protein catabolic process
GO:0009893	0.866	positive regulation of metabolic process
GO:0010604	0.857	positive regulation of macromolecule metabolic process
GO:0050896	0.852	response to stimulus
GO:0051173	0.852	positive regulation of nitrogen compound metabolic process
GO:0070647	0.828	protein modification by small protein conjugation or removal
GO:0048522	0.669	positive regulation of cellular process
GO:0009896	0.562	positive regulation of catabolic process
GO:0045732	0.548	positive regulation of protein catabolic process
GO:1903052	0.528	positive regulation of proteolysis involved in protein catabolic process
GO:0006950	0.510	response to stress
GO:0006511	0.450	ubiquitin-dependent protein catabolic process
GO:1901800	0.405	positive regulation of proteasomal protein catabolic process
GO:0031329	0.396	regulation of cellular catabolic process
GO:0032446	0.380	protein modification by small protein conjugation
GO:0031331	0.377	positive regulation of cellular catabolic process
GO:0002376	0.361	immune system process
GO:0032434	0.326	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0042221	0.319	response to chemical
GO:0009605	0.318	response to external stimulus
GO:0010033	0.303	response to organic substance
GO:0044419	0.302	biological process involved in interspecies interaction between organisms

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005730	0.993	nucleolus
GO:0032991	0.617	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]