StarFunc result for job id Q9Y5A9

User Input

>input (579 residues)
MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYY
SPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQH
GFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAP
GMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWA
DIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPT
QGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSG
FGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSE
DDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYN
TCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQV
LKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91YT7	0.596	0.596	2.877E-85	579	0.997	0.997	Q91YT7.pdb.gz	YTHD2_MOUSE YTH domain-containing family protein 2 OS=Mus musculus OX=10090 GN=Ythdf2 PE=1 SV=1
2	AFDB:E7F1H9	0.380	0.360	2.004E-66	613	0.769	0.726	E7F1H9.pdb.gz	YTHD2_DANRE YTH domain-containing family protein 2 OS=Danio rerio OX=7955 GN=ythdf2 PE=1 SV=1
3	AFDB:B4DPX9	0.409	0.403	7.972E-61	588	0.674	0.663	B4DPX9.pdb.gz	B4DPX9_HUMAN YTH domain-containing family protein OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:P59326	0.373	0.385	5.634E-60	559	0.665	0.689	P59326.pdb.gz	YTHD1_MOUSE YTH domain-containing family protein 1 OS=Mus musculus OX=10090 GN=Ythdf1 PE=1 SV=1
5	AFDB:Q802Z0	0.473	0.449	6.367E-60	614	0.646	0.609	Q802Z0.pdb.gz	Q802Z0_DANRE YTH domain-containing family protein OS=Danio rerio OX=7955 GN=fb49c02 PE=1 SV=1
6	AFDB:Q9VBZ5	0.317	0.263	1.122E-30	700	0.318	0.263	Q9VBZ5.pdb.gz	YTHDF_DROME YTH domain-containing family protein OS=Drosophila melanogaster OX=7227 GN=Ythdf PE=1 SV=1
7	AFDB:Q0WR25	0.305	0.278	2.193E-27	634	0.290	0.265	Q0WR25.pdb.gz	Q0WR25_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT5 PE=1 SV=1
8	AFDB:F4I0C2	0.316	0.305	3.875E-26	599	0.288	0.279	F4I0C2.pdb.gz	F4I0C2_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT4 PE=1 SV=1
9	AFDB:Q9LJE5	0.323	0.282	5.702E-25	667	0.269	0.234	Q9LJE5.pdb.gz	ECT2_ARATH YTH domain-containing protein ECT2 OS=Arabidopsis thaliana OX=3702 GN=ECT2 PE=1 SV=1
10	PDB:5j3eA	0.176	0.496	4.254E-3	172	0.040	0.134	5j3eA.pdb.gz	Crystal Structure of Human THYN1 protein in complex with 5-methylcytosine containing DNA
11	AFDB:Q8CH19	0.080	0.068	7.000E-2	720	0.147	0.118	Q8CH19.pdb.gz	CS2IP_MOUSE Casein kinase II subunit alpha'-interacting protein OS=Mus musculus OX=10090 GN=Csnka2ip PE=1 SV=2
12	PDB:1m2vA	0.068	0.058	3.259E-1	705	0.022	0.018	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
13	PDB:1gshA	0.082	0.139	3.683E-1	296	0.016	0.030	1gshA.pdb.gz
14	PDB:7mq8SM	0.054	0.087	5.649E-1	290	0.019	0.038	7mq8SM.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6h0gB	0.086	0.111	6.383E-1	401	0.033	0.047	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
16	PDB:1gsaA	0.084	0.136	8.151E-1	314	0.017	0.032	1gsaA.pdb.gz	A pseudo-michaelis quaternary complex in the reverse reaction of a ligase: structure of Escherichia coli B glutathione synthetase complexed with ADP, glutathione, and sulfate at 2.0 A resolution.
17	PDB:6c0fv	0.063	0.135	1.413	225	0.028	0.071	6c0fv.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
18	PDB:7nacA	0.052	0.100	1.413	266	0.033	0.071	7nacA.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
19	PDB:7ajtCJ	0.058	0.100	1.596	282	0.026	0.053	7ajtCJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:2hqsA	0.070	0.090	1.918	412	0.017	0.024	2hqsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F1H9	0.0	803	613	0.755	0.713	YTHD2_DANRE YTH domain-containing family protein 2 OS=Danio rerio OX=7955 GN=ythdf2 PE=1 SV=1
2	P59326	0.0	706	559	0.651	0.674	YTHD1_MOUSE YTH domain-containing family protein 1 OS=Mus musculus OX=10090 GN=Ythdf1 PE=1 SV=1
3	Q802Z0	0.0	670	614	0.622	0.586	Q802Z0_DANRE YTH domain-containing family protein OS=Danio rerio OX=7955 GN=fb49c02 PE=1 SV=1
4	Q91YT7	0.0	1186	579	0.997	0.997	YTHD2_MOUSE YTH domain-containing family protein 2 OS=Mus musculus OX=10090 GN=Ythdf2 PE=1 SV=1
5	Q9BYJ9	0.0	706	559	0.655	0.678	YTHD1_HUMAN YTH domain-containing family protein 1 OS=Homo sapiens OX=9606 GN=YTHDF1 PE=1 SV=1
6	Q9Y5A9	0.0	1189	579	1.000	1.000	YTHD2_HUMAN YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2
7	B4DPX9	2.05e-126	385	588	0.311	0.306	B4DPX9_HUMAN YTH domain-containing family protein OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q8BYK6	3.01e-126	385	585	0.309	0.306	YTHD3_MOUSE YTH domain-containing family protein 3 OS=Mus musculus OX=10090 GN=Ythdf3 PE=1 SV=2
9	Q7Z739	3.50e-126	384	585	0.309	0.306	YTHD3_HUMAN YTH domain-containing family protein 3 OS=Homo sapiens OX=9606 GN=YTHDF3 PE=1 SV=1
10	Q9VBZ5	3.70e-81	270	700	0.219	0.181	YTHDF_DROME YTH domain-containing family protein OS=Drosophila melanogaster OX=7227 GN=Ythdf PE=1 SV=1
11	Q9FPE7	2.19e-62	216	528	0.218	0.239	Q9FPE7_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT8 PE=1 SV=1
12	Q0WR25	5.49e-62	218	634	0.174	0.159	Q0WR25_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT5 PE=1 SV=1
13	F4K1Z0	7.46e-60	208	495	0.197	0.230	ECT3_ARATH YTH domain-containing protein ECT3 OS=Arabidopsis thaliana OX=3702 GN=ECT3 PE=1 SV=1
14	Q9LJE5	1.91e-59	211	667	0.173	0.150	ECT2_ARATH YTH domain-containing protein ECT2 OS=Arabidopsis thaliana OX=3702 GN=ECT2 PE=1 SV=1
15	F4KDJ9	1.97e-59	208	528	0.169	0.186	F4KDJ9_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT10 PE=1 SV=1
16	F4I0C2	3.92e-59	209	599	0.171	0.165	F4I0C2_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT4 PE=1 SV=1
17	F4HWS5	9.33e-57	203	639	0.157	0.142	F4HWS5_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT7 PE=1 SV=1
18	Q3MK94	1.44e-55	195	428	0.164	0.222	ECT1_ARATH YTH domain-containing protein ECT1 OS=Arabidopsis thaliana OX=3702 GN=ECT1 PE=1 SV=1
19	Q1JPL5	2.21e-55	199	595	0.159	0.155	Q1JPL5_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT6 PE=1 SV=1
20	Q56XH8	4.99e-51	184	470	0.149	0.183	Q56XH8_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04146 YTH	4.5e-39	146.0	YT521-B-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000012012

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005319	0.815	Zinc finger, C3H1-type containing
2	61853.ENSNLEP00000004584	0.721	CCR4-NOT transcription complex, subunit 1
3	61853.ENSNLEP00000013487	0.698	Wilms tumor 1 associated protein
4	61853.ENSNLEP00000016920	0.695	AlkB family member 5, RNA demethylase
5	61853.ENSNLEP00000001383	0.693	FTO, alpha-ketoglutarate dependent dioxygenase
6	61853.ENSNLEP00000010848	0.693	Methyltransferase like 14
7	61853.ENSNLEP00000017753	0.691	Methyltransferase like 3
8	61853.ENSNLEP00000003915	0.630	Vir like m6A methyltransferase associated
9	61853.ENSNLEP00000013467	0.627	Cleavage and polyadenylation specific factor 4, 30kDa
10	61853.ENSNLEP00000011650	0.626	Exosome component 10
11	61853.ENSNLEP00000001766	0.615	Ski2 like RNA helicase 2
12	61853.ENSNLEP00000004348	0.570	RNA binding motif protein 15
13	61853.ENSNLEP00000003059	0.567	Reactive intermediate imine deaminase A homolog
14	61853.ENSNLEP00000003079	0.566	CCR4-NOT transcription complex, subunit 7
15	61853.ENSNLEP00000006372	0.559	Meiosis specific with coiled-coil domain
16	61853.ENSNLEP00000001996	0.547	Zinc finger CCCH-type containing 3
17	61853.ENSNLEP00000022433	0.539	RNA binding motif protein 15B
18	61853.ENSNLEP00000001678	0.530	AlkB homolog 2, alpha-ketoglutarate dependent dioxygenase
19	61853.ENSNLEP00000020347	0.530	AlkB homolog 1, histone H2A dioxygenase
20	61853.ENSNLEP00000021410	0.516	Eukaryotic translation initiation factor 4 gamma, 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990247	1.000	N6-methyladenosine-containing RNA binding
GO:0005515	0.947	protein binding
GO:0003729	0.730	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0019222	0.985	regulation of metabolic process
GO:0080090	0.984	regulation of primary metabolic process
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0010468	0.981	regulation of gene expression
GO:0016070	0.977	RNA metabolic process
GO:0017148	0.971	negative regulation of translation
GO:0061014	0.969	positive regulation of mRNA catabolic process
GO:0061157	0.964	mRNA destabilization
GO:0044260	0.944	cellular macromolecule metabolic process
GO:0016071	0.910	mRNA metabolic process
GO:0019439	0.890	aromatic compound catabolic process
GO:0006401	0.870	RNA catabolic process
GO:0006402	0.780	mRNA catabolic process
GO:0050793	0.729	regulation of developmental process
GO:0045595	0.621	regulation of cell differentiation
GO:2000736	0.584	regulation of stem cell differentiation
GO:0071840	0.382	cellular component organization or biogenesis
GO:0034250	0.350	positive regulation of amide metabolic process
GO:0045727	0.341	positive regulation of translation
GO:0032501	0.311	multicellular organismal process
GO:0048583	0.303	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005634	0.992	nucleus
GO:0005829	0.966	cytosol
GO:0043232	0.939	intracellular non-membrane-bounded organelle
GO:0031981	0.877	nuclear lumen
GO:0005654	0.754	nucleoplasm
GO:0032991	0.587	protein-containing complex
GO:0035770	0.454	ribonucleoprotein granule
GO:0036464	0.443	cytoplasmic ribonucleoprotein granule
GO:0010494	0.431	cytoplasmic stress granule
GO:0000932	0.413	P-body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]