StarFunc result for job id Q9Y5B0

User Input

>input (961 residues)
MEVPAAGRVPAEGAPTAAVAEVRCPGPAPLRLLEWRVAAGAAVRIGSVLAVFEAAASAQS
SGASQSRVASGGCVRPARPERRLRSERAGVVRELCAQPGQVVAPGAVLVRLEGCSHPVVM
KGLCAECGQDLTQLQSKNGKQQVPLSTATVSMVHSVPELMVSSEQAEQLGREDQQRLHRN
RKLVLMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLY
ELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCI
IDDREDVWKFAPNLITVKKYVYFQGTGDMNAPPGSRESQTRKKVNHSRGTEVSEPSPPVR
DPEGVTQAPGVEPSNGLEKPARELNGSEAATPRDSPRPGKPDERDIWPPAQAPTSSQELA
GAPEPQGSCAQGGRVAPGQRPAQGATGTDLDFDLSSDSESSSESEGTKSSSSASDGESEG
KRGRQKPKAAPEGAGALAQGSSLEPGRPAAPSLPGEAEPGAHAPDKEPELGGQEEGERDG
LCGLGNGCADRKEAETESQNSELSGVTAGESLDQSMEEEEEEDTDEDDHLIYLEEILVRV
HTDYYAKYDRYLNKEIEEAPDIRKIVPELKSKVLADVAIIFSGLHPTNFPIEKTREHYHA
TALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDK
VEEQLFPLRDDHTKAQRENSPAAFPDREGVPPTALFHPMPVLPKAQPGPEVRIYDSNTGK
LIRTGARGPPAPSSSLPIRQEPSSFRAVPPPQPQMFGEELPDAQDGEQPGPSRRKRQPSM
SETMPLYTLCKEDLESMDKEVDDILGEGSDDSDSEKRRPEEQEEEPQPRKPGTRRERTLG
APASSERSAAGGRGPRGHKRKLNEEDAASESSRESSNEDEGSSSEADEMAKALEAELNDL
M

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5B0	1.000	1.000	0.000	961	1.000	1.000	Q9Y5B0.pdb.gz	CTDP1_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens OX=9606 GN=CTDP1 PE=1 SV=3
2	PDB:4hnvB	0.067	0.063	1.849E-4	1033	0.019	0.017	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
3	PDB:3bg5B	0.067	0.060	2.488E-4	1074	0.019	0.017	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
4	PDB:3bg5A	0.067	0.057	4.502E-4	1137	0.019	0.016	3bg5A.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
5	PDB:4rcnB	0.074	0.071	6.819E-4	1000	0.021	0.020	4rcnB.pdb.gz
6	PDB:3n6rG	0.071	0.104	1.983E-3	646	0.025	0.037	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
7	PDB:7wtbB	0.066	0.056	1.983E-3	1147	0.018	0.015	7wtbB.pdb.gz	Mechanistic insight into allosteric activation of human pyruvate carboxylase by acetyl-CoA.
8	PDB:4rcnA	0.073	0.073	2.105E-3	972	0.022	0.022	4rcnA.pdb.gz
9	PDB:3n6rA	0.071	0.114	2.831E-3	591	0.025	0.041	3n6rA.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
10	PDB:4hr7B	0.070	0.757	3.188E-3	80	0.018	0.212	4hr7B.pdb.gz
11	PDB:7nacn	0.082	0.178	7.313E-3	425	0.014	0.031	7nacn.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	AFDB:Q9VCH5	0.044	0.027	4.934E-2	1960	0.147	0.072	Q9VCH5.pdb.gz	NUP98_DROME Nuclear pore complex protein Nup98-Nup96 OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=1 SV=3
13	AFDB:P87323	0.064	0.104	5.292E-1	522	0.060	0.111	P87323.pdb.gz	MCS4_SCHPO Response regulator mcs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcs4 PE=4 SV=1
14	AFDB:Q02630	0.042	0.038	5.958E-1	1113	0.091	0.078	Q02630.pdb.gz	NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP116 PE=1 SV=2
15	AFDB:Q24146	0.042	0.037	7.119E-1	1113	0.082	0.071	Q24146.pdb.gz	Q24146_DROME HLH106 OS=Drosophila melanogaster OX=7227 GN=SREBP PE=2 SV=1
16	AFDB:Q5HZG4	0.039	0.040	8.015E-1	932	0.095	0.098	Q5HZG4.pdb.gz	TAF3_MOUSE Transcription initiation factor TFIID subunit 3 OS=Mus musculus OX=10090 GN=Taf3 PE=1 SV=2
17	AFDB:A0A0R4IZU1	0.054	0.044	8.505E-1	1347	0.086	0.062	A0A0R4IZU1.pdb.gz
18	AFDB:M9PB92	0.047	0.044	1.016	1062	0.093	0.084	M9PB92.pdb.gz	M9PB92_DROME CCR4-NOT transcription complex subunit 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cnot4 PE=1 SV=1
19	AFDB:A7UMX5	0.038	0.037	1.214	996	0.125	0.120	A7UMX5.pdb.gz	A7UMX5_MELGA Synaptopodin 2 variant OS=Meleagris gallopavo OX=9103 PE=2 SV=1
20	AFDB:P38398	0.095	0.052	1.288	1863	0.052	0.027	P38398.pdb.gz	BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MR03	0.0	709	392	0.360	0.883	A0A0A0MR03_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=CTDP1 PE=1 SV=2
2	A0A0G2K0J7	0.0	1393	1030	0.786	0.733	A0A0G2K0J7_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ctdp1 PE=1 SV=1
3	A0A8I6G995	0.0	1173	935	0.653	0.672	A0A8I6G995_RAT RNA polymerase II subunit A C-terminal domain phosphatase OS=Rattus norvegicus OX=10116 GN=Ctdp1 PE=1 SV=1
4	K7EJD2	0.0	1630	799	0.824	0.991	K7EJD2_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=CTDP1 PE=1 SV=1
5	Q7TSG2	0.0	1376	960	0.786	0.786	CTDP1_MOUSE RNA polymerase II subunit A C-terminal domain phosphatase OS=Mus musculus OX=10090 GN=Ctdp1 PE=1 SV=1
6	Q9Y5B0	0.0	1955	961	1.000	1.000	CTDP1_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens OX=9606 GN=CTDP1 PE=1 SV=3
7	Q9W147	1.88e-86	298	880	0.156	0.170	Q9W147_DROME RNA polymerase II subunit A C-terminal domain phosphatase OS=Drosophila melanogaster OX=7227 GN=Fcp1 PE=1 SV=1
8	Q8MQY2	3.39e-86	298	896	0.157	0.169	Q8MQY2_DROME RNA polymerase II subunit A C-terminal domain phosphatase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Fcp1 PE=2 SV=1
9	Q95QG8	6.13e-67	239	659	0.127	0.185	FCP1_CAEEL RNA polymerase II subunit A C-terminal domain phosphatase OS=Caenorhabditis elegans OX=6239 GN=fcp-1 PE=1 SV=2
10	A0A8I6AIS1	4.74e-66	221	172	0.132	0.738	A0A8I6AIS1_RAT CTD phosphatase subunit 1 OS=Rattus norvegicus OX=10116 GN=Ctdp1 PE=1 SV=1
11	Q9P376	4.78e-45	176	723	0.098	0.130	FCP1_SCHPO RNA polymerase II subunit A C-terminal domain phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fcp1 PE=1 SV=1
12	Q03254	5.27e-34	142	732	0.088	0.116	FCP1_YEAST RNA polymerase II subunit A C-terminal domain phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FCP1 PE=1 SV=1
13	Q00IB6	1.70e-20	97.8	440	0.087	0.191	CPL4_ARATH RNA polymerase II C-terminal domain phosphatase-like 4 OS=Arabidopsis thaliana OX=3702 GN=CPL4 PE=1 SV=1
14	Q8LL04	1.91e-18	93.6	1241	0.063	0.049	CPL3_ARATH RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana OX=3702 GN=CPL3 PE=1 SV=2
15	Q9LYI7	3.16e-17	85.9	305	0.046	0.144	Q9LYI7_ARATH At5g11860 OS=Arabidopsis thaliana OX=3702 GN=SSP5 PE=1 SV=1
16	F4JCB2	2.53e-14	79.3	601	0.066	0.105	CPL5_ARATH RNA polymerase II C-terminal domain phosphatase-like 5 OS=Arabidopsis thaliana OX=3702 GN=CPL5 PE=1 SV=2
17	F4KHG9	2.66e-12	72.4	456	0.037	0.079	F4KHG9_ARATH SCP1-like small phosphatase 4 OS=Arabidopsis thaliana OX=3702 GN=SSP4 PE=4 SV=1
18	Q05D32	8.73e-11	67.8	466	0.032	0.067	CTSL2_HUMAN CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=2
19	Q8BG15	9.01e-11	67.8	465	0.032	0.067	CTSL2_MOUSE CTD small phosphatase-like protein 2 OS=Mus musculus OX=10090 GN=Ctdspl2 PE=1 SV=1
20	F4JQR6	2.91e-10	65.9	446	0.032	0.070	F4JQR6_ARATH SCP1-like small phosphatase 4b OS=Arabidopsis thaliana OX=3702 GN=SSP4B PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00364 Biotin_lipoyl	57	15.0	Biotin-requiring enzyme
2	PF00533 BRCT	8.4	18.1	BRCA1 C Terminus (BRCT) domain
3	PF09309 FCP1_C	1e-114	394.4	FCP1, C-terminal
4	PF13437 HlyD_3	5.1e+02	12.7	HlyD family secretion protein
5	PF16576 HlyD_D23	1.7e+02	12.9	Barrel-sandwich domain of CusB or HlyD membrane-fusion
6	PF16759 LIG3_BRCT	4.5e+02	12.6	DNA ligase 3 BRCT domain
7	PF03031 NIF	1.6e-20	84.9	NLI interacting factor-like phosphatase
8	PF12738 PTCB-BRCT	1.5	20.2	twin BRCT domain
9	PF16770 RTT107_BRCT_5	2.1	19.6	Regulator of Ty1 transposition protein 107 BRCT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484525

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377969	0.999	General transcription factor IIF subunit 1
2	9606.ENSP00000480158	0.999	DNA-directed RNA polymerase II subunit RPB1
3	9606.ENSP00000340823	0.996	General transcription factor IIF subunit 2
4	9606.ENSP00000370625	0.994	DNA-directed RNA polymerase II subunit RPB2
5	9606.ENSP00000359531	0.989	Transcription initiation factor IIB
6	9606.ENSP00000301788	0.985	DNA-directed RNA polymerase II subunit RPB7
7	9606.ENSP00000470252	0.969	Transcription elongation factor SPT5
8	9606.ENSP00000272645	0.966	DNA-directed RNA polymerase II subunit RPB4
9	9606.ENSP00000292614	0.960	DNA-directed RNA polymerase II subunit RPB11-a
10	9606.ENSP00000403852	0.960	DNA-directed RNA polymerases I, II, and III subunit RPABC2
11	9606.ENSP00000291386	0.957	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
12	9606.ENSP00000478303	0.954	DNA-directed RNA polymerases I, II, and III subunit RPABC1
13	9606.ENSP00000219252	0.951	DNA-directed RNA polymerase II subunit RPB3
14	9606.ENSP00000362361	0.951	Cyclin-dependent kinase 9
15	9606.ENSP00000428426	0.938	Transcription elongation factor A protein 1
16	9606.ENSP00000225504	0.907	Transcription elongation factor SPT4
17	9606.ENSP00000256443	0.906	Cyclin-dependent kinase 7
18	9606.ENSP00000476948	0.902	Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2
19	9606.ENSP00000295321	0.894	Protein IWS1 homolog
20	9606.ENSP00000235090	0.890	Methylosome protein 50

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004722	0.999	protein serine/threonine phosphatase activity
GO:0008420	0.994	RNA polymerase II CTD heptapeptide repeat phosphatase activity
GO:0008134	0.973	transcription factor binding
GO:0001099	0.969	basal RNA polymerase II transcription machinery binding
GO:0030957	0.925	Tat protein binding
GO:0001091	0.924	RNA polymerase II general transcription initiation factor binding
GO:0001096	0.877	TFIIF-class transcription factor complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:1901360	0.975	organic cyclic compound metabolic process
GO:0043170	0.944	macromolecule metabolic process
GO:0006139	0.928	nucleobase-containing compound metabolic process
GO:0090304	0.920	nucleic acid metabolic process
GO:0065007	0.895	biological regulation
GO:0050789	0.884	regulation of biological process
GO:0006366	0.875	transcription by RNA polymerase II
GO:1901564	0.847	organonitrogen compound metabolic process
GO:0050794	0.831	regulation of cellular process
GO:0043412	0.754	macromolecule modification
GO:0036211	0.743	protein modification process
GO:0071840	0.544	cellular component organization or biogenesis
GO:0016043	0.509	cellular component organization
GO:0006793	0.487	phosphorus metabolic process
GO:0048519	0.416	negative regulation of biological process
GO:0006796	0.342	phosphate-containing compound metabolic process
GO:0016311	0.312	dephosphorylation
GO:0019222	0.302	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0032991	0.979	protein-containing complex
GO:0140513	0.807	nuclear protein-containing complex
GO:0015630	0.746	microtubule cytoskeleton
GO:0005737	0.586	cytoplasm
GO:0005815	0.580	microtubule organizing center
GO:0005819	0.554	spindle
GO:0030496	0.506	midbody
GO:0005813	0.442	centrosome
GO:0000922	0.435	spindle pole
GO:0051233	0.427	spindle midzone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	0.999	protein-serine/threonine phosphatase.

[back to server]