StarFunc result for job id Q9Y5B6

User Input

>input (917 residues)
MFRKARRVNVRKRNDSEEEERERDEEQEPPPLLPPPGTGEEAGPGGGDRAPGGESLLGPG
PSPPSALTPGLGAEAGGGFPGGAEPGNGLKPRKRPRENKEVPRASLLSFQDEEEENEEVF
KVKKSSYSKKIVKLLKKEYKEDLEKSKIKTELNSSAESEQPLDKTGHVKDTNQEDGVIIS
EHGEDEMDMESEKEEEKPKTGGAFSNALSSLNVLRPGEIPDAAFIHAARKKRQMARELGD
FTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEKSQRQKIAEEIGIEGSDDDAL
VTGEQDEELSRWEQEQIRKGINIPQVQASQPAEVNMYYQNTYQTMPYGSSYGIPYSYTAY
GSSDAKSQKTDNTVPFKTPSNEMTPVTIDLVKKQLKDRLDSMKELHKTNRQQHEKHLQSR
VDSTRAIERLEGSSGGIGERYKFLQEMRGYVQDLLECFSEKVPLINELESAIHQLYKQRA
SRLVQRRQDDIKDESSEFSSHSNKALMAPNLDSFGRDRALYQEHAKRRIAEREARRTRRR
QAREQTGKMADHLEGLSSDDEETSTDITNFNLEKDRISKESGKVFEDVLESFYSIDCIKS
QFEAWRSKYYTSYKDAYIGLCLPKLFNPLIRLQLLTWTPLEAKCRDFENMLWFESLLFYG
CEEREQEKDDVDVALLPTIVEKVILPKLTVIAENMWDPFSTTQTSRMVGITLKLINGYPS
VVNAENKNTQVYLKALLLRMRRTLDDDVFMPLYPKNVLENKNSGPYLFFQRQFWSSVKLL
GNFLQWYGIFSNKTLQELSIDGLLNRYILMAFQNSEYGDDSIKKAQNVINCFPKQWFMNL
KGERTISQLENFCRYLVHLADTIYRNSIGCSDVEKRNARENIKQIVKLLASVRALDHAMS
VASDHNVKEFKSLIEGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58501	0.584	0.583	9.450E-97	919	0.954	0.952	P58501.pdb.gz	PAXB1_MOUSE PAX3- and PAX7-binding protein 1 OS=Mus musculus OX=10090 GN=Paxbp1 PE=1 SV=3
2	AFDB:Q68CQ1	0.105	0.080	7.617E-3	1323	0.135	0.094	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
3	AFDB:Q09829	0.107	0.119	1.941E-2	780	0.108	0.127	Q09829.pdb.gz	YAD3_SCHPO Pumilio domain-containing protein C4G8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G8.03c PE=4 SV=1
4	AFDB:Q10435	0.114	0.077	3.571E-2	1647	0.126	0.070	Q10435.pdb.gz	YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC12B10.01c PE=3 SV=2
5	PDB:7a9wA	0.103	0.160	3.909E-2	513	0.062	0.111	7a9wA.pdb.gz	The pentatricopeptide repeat protein Rmd9 recognizes the dodecameric element in the 3'-UTRs of yeast mitochondrial mRNAs.
6	PDB:4q66B	0.090	0.140	4.416E-2	507	0.057	0.103	4q66B.pdb.gz	Structural basis for membrane binding and remodeling by the exomer secretory vesicle cargo adaptor.
7	AFDB:Q9VJ35	0.106	0.069	7.733E-2	1732	0.150	0.080	Q9VJ35.pdb.gz	Q9VJ35_DROME LD01527p OS=Drosophila melanogaster OX=7227 GN=ssp3 PE=2 SV=3
8	AFDB:Q14669	0.122	0.072	8.736E-2	1992	0.113	0.052	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
9	PDB:3nd2A	0.114	0.119	9.180E-2	861	0.059	0.063	3nd2A.pdb.gz
10	AFDB:O94462	0.086	0.099	9.476E-2	732	0.122	0.153	O94462.pdb.gz	PUF3_SCHPO mRNA-binding protein puf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=puf3 PE=2 SV=4
11	AFDB:E5FYH1	0.083	0.059	9.869E-2	1653	0.147	0.082	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
12	PDB:7f4uA	0.112	0.164	1.037E-1	440	0.050	0.105	7f4uA.pdb.gz
13	AFDB:Q8IN89	0.099	0.094	1.071E-1	984	0.117	0.109	Q8IN89.pdb.gz	Q8IN89_DROME Well-rounded, isoform B OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
14	AFDB:Q9Y4F4	0.099	0.058	1.071E-1	1720	0.133	0.071	Q9Y4F4.pdb.gz	TGRM1_HUMAN TOG array regulator of axonemal microtubules protein 1 OS=Homo sapiens OX=9606 GN=TOGARAM1 PE=1 SV=4
15	PDB:4in3D	0.098	0.135	1.436E-1	632	0.055	0.079	4in3D.pdb.gz
16	PDB:7zf1B	0.106	0.093	1.495E-1	1179	0.056	0.043	7zf1B.pdb.gz
17	PDB:6q82A	0.114	0.104	1.988E-1	1027	0.056	0.050	6q82A.pdb.gz	Structural basis for the nuclear import and export functions of the biportin Pdr6/Kap122.
18	PDB:2xwuB	0.101	0.101	2.246E-1	910	0.049	0.049	2xwuB.pdb.gz
19	PDB:7ajlAAA	0.081	0.203	2.246E-1	290	0.040	0.128	7ajlAAA.pdb.gz
20	PDB:4r0zA	0.111	0.150	2.339E-1	557	0.059	0.097	4r0zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58501	0.0	1579	919	0.954	0.952	PAXB1_MOUSE PAX3- and PAX7-binding protein 1 OS=Mus musculus OX=10090 GN=Paxbp1 PE=1 SV=3
2	Q9Y5B6	0.0	1897	917	1.000	1.000	PAXB1_HUMAN PAX3- and PAX7-binding protein 1 OS=Homo sapiens OX=9606 GN=PAXBP1 PE=1 SV=2
3	P16383	6.78e-130	411	781	0.264	0.310	GCFC2_HUMAN Intron Large complex component GCFC2 OS=Homo sapiens OX=9606 GN=GCFC2 PE=1 SV=2
4	Q9VI54	7.22e-92	313	905	0.268	0.272	Q9VI54_DROME LD29489p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1965 PE=1 SV=3
5	Q8MRQ8	4.24e-83	281	581	0.215	0.339	Q8MRQ8_DROME GH04034p OS=Drosophila melanogaster OX=7227 GN=CG1965 PE=2 SV=1
6	Q9FNN3	1.51e-45	179	908	0.184	0.186	ILP1_ARATH Transcriptional repressor ILP1 OS=Arabidopsis thaliana OX=3702 GN=ILP1 PE=1 SV=1
7	A0A0B4KF71	0.002	42.4	176	0.023	0.119	A0A0B4KF71_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1965 PE=4 SV=1
8	A0A0B4K6A9	0.004	42.7	317	0.023	0.066	A0A0B4K6A9_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1965 PE=4 SV=1
9	O75962	0.031	40.8	3097	0.035	0.010	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
10	A2AL36	0.055	40.0	2334	0.027	0.011	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
11	O97267	0.28	37.7	2114	0.024	0.010	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
12	M9MRJ4	0.85	36.2	13540	0.017	0.001	M9MRJ4_DROME Muscle-specific protein 300 kDa, isoform G OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
13	M9PEP8	1.3	35.4	6685	0.019	0.003	M9PEP8_DROME Muscle-specific protein 300 kDa, isoform M OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
14	Q7KMH9	1.4	35.0	1420	0.025	0.016	Q7KMH9_DROME BcDNA.LD26050 OS=Drosophila melanogaster OX=7227 GN=wde PE=1 SV=1
15	M9MRD1	1.6	35.0	12345	0.019	0.001	MS300_DROME Muscle-specific protein 300 kDa OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
16	M9MRD6	1.6	35.0	11999	0.019	0.001	M9MRD6_DROME Muscle-specific protein 300 kDa, isoform I OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
17	M9MRF5	1.6	35.0	11986	0.019	0.001	M9MRF5_DROME Muscle-specific protein 300 kDa, isoform H OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
18	M9PC84	1.6	35.0	12308	0.019	0.001	M9PC84_DROME Muscle-specific protein 300 kDa, isoform L OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
19	M9PCM8	1.6	35.0	11917	0.019	0.001	M9PCM8_DROME Muscle-specific protein 300 kDa, isoform K OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
20	M9PC23	1.7	35.0	7962	0.019	0.002	M9PC23_DROME Muscle-specific protein 300 kDa, isoform J OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07842 GCFC	5.6e-31	119.8	GC-rich sequence DNA-binding factor-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328992

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481697	0.874	Serine/Arginine-related protein 53
2	9606.ENSP00000358242	0.828	Arginine/serine-rich protein PNISR
3	9606.ENSP00000310723	0.813	Probable ATP-dependent RNA helicase DDX23
4	9606.ENSP00000253363	0.794	RNA-binding protein 39
5	9606.ENSP00000263694	0.787	U5 small nuclear ribonucleoprotein 40 kDa protein
6	9606.ENSP00000384421	0.784	Tuftelin-interacting protein 11
7	9606.ENSP00000248901	0.742	Cytohesin-4
8	9606.ENSP00000331087	0.722	Protein TSSC4
9	9606.ENSP00000460348	0.719	Pre-mRNA-processing-splicing factor 8
10	9606.ENSP00000321805	0.703	GTP-binding protein Rit2
11	9606.ENSP00000316948	0.699	Dual specificity protein kinase CLK4
12	9606.ENSP00000160373	0.689	Cortactin-binding protein 2
13	9606.ENSP00000382104	0.679	Protein dopey-2
14	9606.ENSP00000293872	0.672	Putative RNA-binding protein Luc7-like 1
15	9606.ENSP00000368017	0.669	Zinc finger C3H1 domain-containing protein
16	9606.ENSP00000444950	0.649	Uncharacterized protein C21orf62
17	9606.ENSP00000439768	0.647	Belongs to the UPF0220 family
18	9606.ENSP00000296015	0.640	Belongs to the TTC14 family
19	9606.ENSP00000352956	0.602	Probable RNA-binding protein 23
20	9606.ENSP00000347005	0.601	Putative RNA-binding protein Luc7-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990226	1.000	histone methyltransferase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0050789	0.990	regulation of biological process
GO:0043170	0.990	macromolecule metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0050794	0.983	regulation of cellular process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0048518	0.976	positive regulation of biological process
GO:0010468	0.970	regulation of gene expression
GO:0051252	0.970	regulation of RNA metabolic process
GO:0048522	0.964	positive regulation of cellular process
GO:0051254	0.929	positive regulation of RNA metabolic process
GO:0006355	0.925	regulation of DNA-templated transcription
GO:0034641	0.913	cellular nitrogen compound metabolic process
GO:0045893	0.904	positive regulation of DNA-templated transcription
GO:0006139	0.879	nucleobase-containing compound metabolic process
GO:0090304	0.867	nucleic acid metabolic process
GO:0010467	0.865	gene expression
GO:0016070	0.863	RNA metabolic process
GO:0006357	0.537	regulation of transcription by RNA polymerase II
GO:0009059	0.527	macromolecule biosynthetic process
GO:0031401	0.527	positive regulation of protein modification process
GO:0034654	0.525	nucleobase-containing compound biosynthetic process
GO:0006351	0.522	DNA-templated transcription
GO:0031056	0.461	regulation of histone modification
GO:0031058	0.453	positive regulation of histone modification
GO:0031060	0.406	regulation of histone methylation
GO:0031062	0.399	positive regulation of histone methylation
GO:0045944	0.397	positive regulation of transcription by RNA polymerase II
GO:0008284	0.357	positive regulation of cell population proliferation
GO:0006397	0.357	mRNA processing
GO:0008380	0.356	RNA splicing
GO:0006366	0.356	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0005634	0.994	nucleus
GO:0005737	0.988	cytoplasm
GO:0005829	0.982	cytosol
GO:0031981	0.956	nuclear lumen
GO:0005654	0.917	nucleoplasm
GO:0032991	0.910	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]