StarFunc result for job id Q9Y5B9

User Input

>input (1047 residues)
MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYE
LTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDK
MIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGEL
NLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVE
MCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQE
NYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGS
LVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTS
VKKKVKNVGIFLKNEDEEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKE
LAAQLNEEAKRRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIM
PVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITY
RASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNP
KLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVL
HFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKTAF
KNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEV
ELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSL
NWTKIMKTIVDDPEGFFEQGGWSFLEPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEE
DSDEDYSSEAEESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKR
KASVHSSGRGSNRGSRHSSAPPKKKRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IRG6	0.760	0.738	0.000	1083	0.591	0.572	Q8IRG6.pdb.gz	SPT16_DROME FACT complex subunit spt16 OS=Drosophila melanogaster OX=7227 GN=dre4 PE=1 SV=2
2	AFDB:Q9N5R9	0.671	0.680	0.000	1030	0.462	0.470	Q9N5R9.pdb.gz	SPT16_CAEEL FACT complex subunit spt-16 OS=Caenorhabditis elegans OX=6239 GN=spt-16 PE=1 SV=1
3	AFDB:Q9W603	0.905	0.915	0.000	1035	0.863	0.873	Q9W603.pdb.gz	SP16H_XENLA FACT complex subunit SPT16 OS=Xenopus laevis OX=8355 GN=supt16h PE=1 SV=2
4	AFDB:Q9Y5B9	1.000	1.000	0.000	1047	1.000	1.000	Q9Y5B9.pdb.gz	SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1
5	AFDB:O94267	0.428	0.439	6.001E-101	1019	0.376	0.387	O94267.pdb.gz	SPT16_SCHPO FACT complex subunit spt16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt16 PE=1 SV=1
6	AFDB:G0SDN1	0.435	0.442	9.699E-99	1029	0.372	0.379	G0SDN1.pdb.gz	G0SDN1_CHATD FACT complex subunit OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0052370 PE=1 SV=1
7	AFDB:O82491	0.471	0.462	2.254E-96	1074	0.365	0.356	O82491.pdb.gz	SPT16_ARATH FACT complex subunit SPT16 OS=Arabidopsis thaliana OX=3702 GN=SPT16 PE=1 SV=1
8	AFDB:P32558	0.411	0.416	1.498E-91	1035	0.339	0.343	P32558.pdb.gz	SPT16_YEAST FACT complex subunit SPT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT16 PE=1 SV=1
9	AFDB:Q580R3	0.411	0.422	1.425E-67	1012	0.234	0.242	Q580R3.pdb.gz	Q580R3_TRYB2 FACT complex subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.860 PE=3 SV=1
10	PDB:7nkyQ	0.333	0.812	4.911E-37	404	0.165	0.428	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
11	AFDB:G0SHK5	0.166	0.292	1.081E-18	571	0.068	0.124	G0SHK5.pdb.gz	G0SHK5_CHATD FACT complex subunit POB3 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0070340 PE=1 SV=1
12	PDB:5cnxA	0.293	0.784	9.590E-18	360	0.071	0.206	5cnxA.pdb.gz	Structures and activities of widely conserved small prokaryotic aminopeptidases-P clarify classification of M24B peptidases
13	PDB:6yo9A	0.298	0.710	8.316E-16	398	0.068	0.178	6yo9A.pdb.gz	Degradation of the microbial stress protectants and chemical chaperones ectoine and hydroxyectoine by a bacterial hydrolase-deacetylase complex.
14	PDB:6a9vA	0.291	0.708	1.971E-14	393	0.064	0.170	6a9vA.pdb.gz	Crystal structures and biochemical analyses of intermediate cleavage peptidase: role of dynamics in enzymatic function.
15	PDB:5x49A	0.282	0.613	2.690E-14	441	0.071	0.168	5x49A.pdb.gz	Structure of the human aminopeptidase XPNPEP3 and comparison of its in vitro activity with Icp55 orthologs: Insights into diverse cellular processes.
16	PDB:2bh3A	0.290	0.629	8.425E-14	440	0.061	0.145	2bh3A.pdb.gz	Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
17	PDB:6upkH	0.165	0.383	1.622E-12	411	0.039	0.100	6upkH.pdb.gz	FACT caught in the act of manipulating the nucleosome.
18	PDB:7nkyO	0.168	0.380	1.622E-12	427	0.045	0.110	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
19	PDB:3ctzA	0.290	0.465	2.871E-12	617	0.070	0.118	3ctzA.pdb.gz	Structure of human cytosolic X-prolyl aminopeptidase: a double Mn(II)-dependent dimeric enzyme with a novel three-domain subunit
20	PDB:5mc1B	0.288	0.571	3.185E-12	485	0.062	0.134	5mc1B.pdb.gz	Structural basis for prolidase deficiency disease mechanisms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G0SDN1	0.0	658	1029	0.372	0.379	G0SDN1_CHATD FACT complex subunit OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0052370 PE=1 SV=1
2	O82491	0.0	634	1074	0.362	0.353	SPT16_ARATH FACT complex subunit SPT16 OS=Arabidopsis thaliana OX=3702 GN=SPT16 PE=1 SV=1
3	O94267	0.0	667	1019	0.374	0.385	SPT16_SCHPO FACT complex subunit spt16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt16 PE=1 SV=1
4	P32558	0.0	556	1035	0.343	0.347	SPT16_YEAST FACT complex subunit SPT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT16 PE=1 SV=1
5	Q8IRG6	0.0	1291	1083	0.586	0.567	SPT16_DROME FACT complex subunit spt16 OS=Drosophila melanogaster OX=7227 GN=dre4 PE=1 SV=2
6	Q9N5R9	0.0	948	1030	0.477	0.484	SPT16_CAEEL FACT complex subunit spt-16 OS=Caenorhabditis elegans OX=6239 GN=spt-16 PE=1 SV=1
7	Q9W603	0.0	1769	1035	0.870	0.880	SP16H_XENLA FACT complex subunit SPT16 OS=Xenopus laevis OX=8355 GN=supt16h PE=1 SV=2
8	Q9Y5B9	0.0	2165	1047	1.000	1.000	SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1
9	Q580R3	4.95e-62	231	1012	0.228	0.236	Q580R3_TRYB2 FACT complex subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.860 PE=3 SV=1
10	P76524	3.87e-05	49.7	361	0.049	0.141	YPDF_ECOLI Aminopeptidase YpdF OS=Escherichia coli (strain K12) OX=83333 GN=ypdF PE=1 SV=1
11	Q6NYT0	5.49e-05	49.3	510	0.058	0.120	Q6NYT0_DANRE Probable Xaa-Pro aminopeptidase 3 OS=Danio rerio OX=7955 GN=zgc:76905 PE=1 SV=1
12	F4HZG9	0.002	44.3	493	0.061	0.130	ICP55_ARATH Intermediate cleaving peptidase 55, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ICP55 PE=1 SV=1
13	Q10439	0.060	39.7	486	0.055	0.119	ICP55_SCHPO Intermediate cleaving peptidase 55 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=icp55 PE=3 SV=2
14	B7ZMP1	0.062	39.7	506	0.054	0.113	XPP3_MOUSE Xaa-Pro aminopeptidase 3 OS=Mus musculus OX=10090 GN=Xpnpep3 PE=1 SV=1
15	F1QEB4	0.093	39.3	705	0.049	0.072	F1QEB4_DANRE FACT complex subunit SSRP1 OS=Danio rerio OX=7955 GN=ssrp1 PE=1 SV=1
16	Q38EM6	0.49	37.0	1690	0.032	0.020	Q38EM6_TRYB2 Adenosine monophosphate deaminase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5250 PE=3 SV=1
17	Q9W602	4.6	33.5	693	0.056	0.085	SSRP1_XENLA FACT complex subunit SSRP1 OS=Xenopus laevis OX=8355 GN=ssrp1 PE=1 SV=1
18	O05579	6.5	32.7	358	0.018	0.053	O05579_MYCTU Probable conserved transmembrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0996 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09186 DUF1949	17	16.7	Domain of unknown function (DUF1949)
2	PF14826 FACT-Spt16_Nlob	3e-48	175.1	FACT complex subunit SPT16 N-terminal lobe domain
3	PF00557 Peptidase_M24	2.6e-31	120.5	Metallopeptidase family M24
4	PF08512 Rtt106	4.4e-14	64.0	Histone chaperone Rttp106-like
5	PF08644 SPT16	1.1e-53	192.9	FACT complex subunit (SPT16/CDC68)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000012562

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000002249	0.999	Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following t [...]
2	60711.ENSCSAP00000000189	0.991	Transcription elongation factor SPT5
3	60711.ENSCSAP00000007549	0.991	Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
4	60711.ENSCSAP00000000915	0.987	CTR9, Paf1/RNA polymerase II complex component
5	60711.ENSCSAP00000003426	0.987	Transcription elongation factor that enhances transcription elongation by RNA polymerase II (RNAPII).
6	60711.ENSCSAP00000003992	0.981	Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
7	60711.ENSCSAP00000002069	0.976	Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates transcription elongation by RNA polymerase II
8	60711.ENSCSAP00000000234	0.973	PAF1 homolog, Paf1/RNA polymerase II complex component
9	60711.ENSCSAP00000004837	0.971	Plays a complex role in regulating the basal catalytic activity of the alpha subunit
10	60711.ENSCSAP00000009583	0.962	Cell division cycle 73
11	60711.ENSCSAP00000007724	0.954	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
12	60711.ENSCSAP00000001100	0.947	Casein kinase 2, alpha prime polypeptide
13	60711.ENSCSAP00000006691	0.933	Belongs to the protein kinase superfamily.
14	60711.ENSCSAP00000018748	0.932	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
15	60711.ENSCSAP00000011431	0.926	Chromodomain helicase DNA binding protein 1
16	60711.ENSCSAP00000003179	0.925	Uncharacterized protein
17	60711.ENSCSAP00000013051	0.917	annotation not available
18	60711.ENSCSAP00000001450	0.901	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
19	60711.ENSCSAP00000010797	0.900	Transcription elongation factor A (SII), 1
20	60711.ENSCSAP00000004856	0.898	UBX domain protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.976	heterocyclic compound binding
GO:0097159	0.976	organic cyclic compound binding
GO:0003676	0.973	nucleic acid binding
GO:0003723	0.867	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0080090	0.981	regulation of primary metabolic process
GO:0090304	0.980	nucleic acid metabolic process
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0031323	0.971	regulation of cellular metabolic process
GO:0048518	0.966	positive regulation of biological process
GO:0010467	0.965	gene expression
GO:0010468	0.963	regulation of gene expression
GO:0048522	0.952	positive regulation of cellular process
GO:0019219	0.949	regulation of nucleobase-containing compound metabolic process
GO:0071824	0.936	protein-DNA complex subunit organization
GO:0051252	0.928	regulation of RNA metabolic process
GO:0010556	0.926	regulation of macromolecule biosynthetic process
GO:0031326	0.926	regulation of cellular biosynthetic process
GO:0006325	0.909	chromatin organization
GO:0031325	0.908	positive regulation of cellular metabolic process
GO:0006338	0.903	chromatin remodeling
GO:0051173	0.900	positive regulation of nitrogen compound metabolic process
GO:0010604	0.900	positive regulation of macromolecule metabolic process
GO:0045935	0.890	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.885	regulation of DNA-templated transcription
GO:0034654	0.885	nucleobase-containing compound biosynthetic process
GO:0051254	0.882	positive regulation of RNA metabolic process
GO:0016070	0.878	RNA metabolic process
GO:0010557	0.869	positive regulation of macromolecule biosynthetic process
GO:0031328	0.867	positive regulation of cellular biosynthetic process
GO:1902680	0.856	positive regulation of RNA biosynthetic process
GO:0009059	0.849	macromolecule biosynthetic process
GO:0045893	0.845	positive regulation of DNA-templated transcription
GO:0034728	0.822	nucleosome organization
GO:0022411	0.803	cellular component disassembly
GO:0032784	0.796	regulation of DNA-templated transcription elongation
GO:0032786	0.763	positive regulation of DNA-templated transcription, elongation
GO:0032984	0.719	protein-containing complex disassembly
GO:0032774	0.690	RNA biosynthetic process
GO:0006351	0.670	DNA-templated transcription
GO:0006366	0.451	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	0.999	chromatin
GO:0008023	0.999	transcription elongation factor complex
GO:0035101	0.690	FACT complex
GO:0005737	0.519	cytoplasm
GO:0005829	0.360	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]