StarFunc result for job id Q9Y5G9

User Input

>input (962 residues)
MHFILDPEDPGAPQASTEGKPKHRRLRGGVVMAAPPARPDHTRLLQICLLLGVLVEIRAE
QILYSVFEEQEEGSVVGNIAKDLGLAPRELAERGVRIVSRGRTQLFALNPRSGTLVTAGR
IDREELCDRSPNCVTNLEILLEDTVKILRVEVEIIDVNDNPPSFGTEQREIKVAENENPG
ARFPLPEAFDPDVGVNSLQGYQLNSNGYFSLDVQSGADGIKYPELVLERALDREEEAVHH
LVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKATDP
DEGANGDVTYSFRKVRDKISQLFQLNSLSGDITILGGLDYEDSGFYDIDVEAHDGPGLRA
RSKVLVTVLDENDNAPEVTVTSLTSSVQESSSPGTVIALFNVHDSDSGGNGLVTCSIPDN
LPFTLEKTYGNYYRLLTHRTLDREEVSEYNITVTATDQGTPPLSTETHISLQVMDINDNP
PTFPHASYSAYIPENNPRGASILSMTAQDPDSGDNARITYSLAEDTFQGAPLSSYVSINS
NTGILYALCSFDYEQFRDLQLLMTASDSGDPPLSSNVSLSLFVLDQNDNVPEILYPTFPT
DGSTGVELAPRSADSGYLVTKVVAVDRDSGQNAWLSYSLLKSSEPGLFAVGLHTGEVRTA
RALLDRDALKQRLVVVVQDHGQPPLSATVTLTVAVADSIPDVLADLGSLKPSADPDDSGL
TLYLVVAVAAVSCVFLAFVTVLLALKLRRWHKSRLLHAEGSRLAGVPASHFVGVDGVRAF
LQTYSHEVSLTADSRKSHLIFSQPSYADTLISRESCEKSEPLLITQDLLETKGDPNLQQA
PPNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGA
GTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
KK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NXY6	0.666	0.688	0.000	931	0.507	0.524	Q6NXY6.pdb.gz	Q6NXY6_MOUSE Pcdhgb7 protein OS=Mus musculus OX=10090 GN=Pcdhgb7 PE=2 SV=1
2	AFDB:Q8CHE5	0.683	0.699	0.000	939	0.716	0.734	Q8CHE5.pdb.gz	Q8CHE5_MOUSE MKIAA0327 splice variant 1 (Fragment) OS=Mus musculus OX=10090 GN=Pcdhga2 PE=2 SV=1
3	AFDB:Q91XX9	0.720	0.741	0.000	932	0.690	0.712	Q91XX9.pdb.gz	Q91XX9_MOUSE Protocadherin gamma A9 OS=Mus musculus OX=10090 GN=Pcdhga9 PE=1 SV=1
4	AFDB:Q91XZ0	0.721	0.742	0.000	931	0.695	0.719	Q91XZ0.pdb.gz	Q91XZ0_MOUSE Protocadherin gamma A1 OS=Mus musculus OX=10090 GN=Pcdhga1 PE=1 SV=1
5	AFDB:Q9Y5G4	0.705	0.727	0.000	932	0.711	0.734	Q9Y5G4.pdb.gz	PCDG9_HUMAN Protocadherin gamma-A9 OS=Homo sapiens OX=9606 GN=PCDHGA9 PE=1 SV=1
6	AFDB:Q9Y5G9	1.000	1.000	0.000	962	1.000	1.000	Q9Y5G9.pdb.gz	PCDG4_HUMAN Protocadherin gamma-A4 OS=Homo sapiens OX=9606 GN=PCDHGA4 PE=1 SV=2
7	AFDB:Q91XX0	0.634	0.647	7.503E-104	941	0.475	0.486	Q91XX0.pdb.gz	Q91XX0_MOUSE Protocadherin gamma C4 OS=Mus musculus OX=10090 GN=Pcdhgc4 PE=1 SV=1
8	AFDB:Q9NRJ7	0.636	0.781	1.836E-96	776	0.358	0.443	Q9NRJ7.pdb.gz	PCDBG_HUMAN Protocadherin beta-16 OS=Homo sapiens OX=9606 GN=PCDHB16 PE=1 SV=4
9	AFDB:Q9Y5F2	0.622	0.737	5.841E-96	797	0.363	0.438	Q9Y5F2.pdb.gz	PCDBB_HUMAN Protocadherin beta-11 OS=Homo sapiens OX=9606 GN=PCDHB11 PE=2 SV=1
10	AFDB:Q9Y5E9	0.669	0.802	9.186E-96	798	0.358	0.431	Q9Y5E9.pdb.gz	PCDBE_HUMAN Protocadherin beta-14 OS=Homo sapiens OX=9606 GN=PCDHB14 PE=1 SV=1
11	PDB:4aq1A	0.103	0.127	1.211E-13	721	0.087	0.117	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
12	PDB:6velC	0.183	0.748	1.811E-13	209	0.055	0.254	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:1e07A	0.148	0.189	3.224E-11	642	0.069	0.103	1e07A.pdb.gz
14	PDB:5oj2B	0.124	0.165	3.793E-10	692	0.088	0.123	5oj2B.pdb.gz
15	PDB:7vonA	0.095	0.072	4.082E-8	1399	0.065	0.045	7vonA.pdb.gz
16	PDB:6dldD	0.122	0.314	2.258E-7	269	0.041	0.145	6dldD.pdb.gz
17	PDB:4ziqA	0.095	0.068	3.376E-7	1450	0.076	0.050	4ziqA.pdb.gz
18	PDB:6dlfA	0.133	0.358	3.376E-7	236	0.046	0.186	6dlfA.pdb.gz
19	PDB:5a42A	0.091	0.060	8.351E-7	1597	0.073	0.044	5a42A.pdb.gz
20	PDB:6h03A	0.090	0.073	3.416E-6	1223	0.073	0.057	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A6YW27	1072	810	0.558	0.663	A0A0A6YW27_MOUSE Protocadherin gamma subfamily A, 1 OS=Mus musculus OX=10090 GN=Pcdhga1 PE=1 SV=1
2	A0A0A6YXT1	1136	813	0.586	0.694	A0A0A6YXT1_MOUSE Protocadherin gamma subfamily A, 7 OS=Mus musculus OX=10090 GN=Pcdhga7 PE=1 SV=1
3	A0A0A6YY44	551	904	0.350	0.373	A0A0A6YY44_MOUSE Protocadherin alpha 11 OS=Mus musculus OX=10090 GN=Pcdha11 PE=1 SV=1
4	A0A2R8QI99	613	997	0.348	0.336	A0A2R8QI99_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=4 SV=1
5	A0PJT6	599	789	0.359	0.437	A0PJT6_MOUSE Protocadherin beta 12 OS=Mus musculus OX=10090 GN=Pcdhb12 PE=2 SV=1
6	B9EJ65	550	904	0.350	0.373	B9EJ65_MOUSE Pcdha11 protein OS=Mus musculus OX=10090 GN=Pcdha11 PE=2 SV=1
7	B9EJ92	554	902	0.357	0.380	B9EJ92_MOUSE Pcdha2 protein OS=Mus musculus OX=10090 GN=Pcdha2 PE=2 SV=1
8	B9EKB6	577	900	0.367	0.392	B9EKB6_MOUSE Pcdha6 protein OS=Mus musculus OX=10090 GN=Pcdha6 PE=2 SV=1
9	E9PX28	595	1047	0.359	0.330	E9PX28_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
10	E9PXQ7	595	1057	0.359	0.326	E9PXQ7_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
11	I6LBX6	1234	931	0.675	0.697	I6LBX6_RAT Protocadherin gamma a9 OS=Rattus norvegicus OX=10116 GN=Pcdhga9 PE=2 SV=1
12	O88192	570	914	0.363	0.382	O88192_MOUSE Cadherin-related neural recepter 5 (Fragment) OS=Mus musculus OX=10090 GN=Pcdha12 PE=2 SV=1
13	O88690	579	946	0.372	0.378	O88690_MOUSE CNR2 OS=Mus musculus OX=10090 GN=Pcdha6 PE=2 SV=1
14	Q05C01	552	926	0.363	0.377	Q05C01_MOUSE Pcdha6 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdha2 PE=2 SV=1
15	Q14BM8	621	802	0.345	0.414	Q14BM8_MOUSE Protocadherin beta 16 OS=Mus musculus OX=10090 GN=Pcdhb16 PE=2 SV=1
16	Q3UTF9	580	874	0.332	0.365	Q3UTF9_MOUSE Cadherin domain-containing protein OS=Mus musculus OX=10090 GN=Pcdhgc4 PE=2 SV=1
17	Q3UTK9	589	671	0.351	0.504	Q3UTK9_MOUSE Cadherin domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdhgc4 PE=2 SV=1
18	Q4KMS2	749	804	0.418	0.500	Q4KMS2_MOUSE Pcdhgb1 protein OS=Mus musculus OX=10090 GN=Pcdhgb1 PE=2 SV=1
19	Q5DTQ9	1300	933	0.676	0.697	Q5DTQ9_MOUSE MKIAA0327 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdhga8 PE=2 SV=1
20	Q641K6	556	902	0.359	0.382	Q641K6_MOUSE Pcdha1 protein OS=Mus musculus OX=10090 GN=Pcdha1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	6.4e-78	268.6	Cadherin domain
2	PF08266 Cadherin_2	1.9e-31	119.0	Cadherin-like
3	PF16492 Cadherin_C_2	6.3e-21	86.2	Cadherin cytoplasmic C-terminal
4	PF15974 Cadherin_tail	1.2e-23	95.5	Cadherin C-terminal cytoplasmic tail, catenin-binding region
5	PF17756 RET_CLD1	34	16.2	RET Cadherin like domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000458570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348368	0.603	Olfactory receptor 52R1
2	9606.ENSP00000356518	0.505	Testicular spindle-associated protein SHCBP1L
3	9606.ENSP00000336661	0.502	Leucine-rich repeat-containing protein 71

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.922	biological regulation
GO:0050789	0.907	regulation of biological process
GO:0050794	0.776	regulation of cellular process
GO:0032502	0.730	developmental process
GO:0071840	0.724	cellular component organization or biogenesis
GO:0048519	0.454	negative regulation of biological process
GO:0050896	0.368	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]