StarFunc result for job id Q9Y5I4

User Input

>input (1007 residues)
MEQAGTRPAATEHPRLRRPMPWLLLLPLLLLLLLLLPGPAASQLRYSVPEEQAPGALVGN
VARALGLELRRLGPGCLRINHLGAPSPRYLELDLTSGALFVNERIDREALCEQRPRCLLS
LEVLAHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGAN
SVQTYELSPSEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGT
AQISVRVLDTNDNSPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYT
SDRERQLFSIDASTGEVRVIGGLDYEEASSYQIYVQATDRGPVPMAGHCKVLVDIVDVND
NAPEVVLTDLYSPVPENATPNTIVAVLSVNDQDSGPNRKVSLGLEATLPFRLNGFGNSYT
LVVSGPLDRERVAVYNITVTATDGGIPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQE
NNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQGLPVTSYVSINSASGSLYAVNSFDYE
KFREFFVTVEAQDKGSPPLSSTVTANVYVVDMNDHAPHILYPTSTNSSAAFEMVPRTAPA
GYLVTKVIAMDSDSGQNAWLFYHLAQTSDLDLFKVELHTGEIRTTRKMGDESGSTFNLTV
VVRDNGEPSLSASVAITVAVVDRVSKILPDTQRHVKSPRTYSEITLYLIIALSTVSFIFL
LTIIILSIIKCYRYTAYGTACCGGFCGVRERSPAELYKQANNNIDARIPHGLKVQPHFIE
VRGNGSLTKTYCYKACLTAGSGSDTFMFYNTGAQTGPGPSGAQAAVTDSRNLTGQSGQNA
GNLIILKNEAVSQNEPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTVS
SATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEP
TNSQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88690	0.619	0.657	0.000	946	0.474	0.504	O88690.pdb.gz	O88690_MOUSE CNR2 OS=Mus musculus OX=10090 GN=Pcdha6 PE=2 SV=1
2	AFDB:Q9Y5H9	0.642	0.679	0.000	948	0.479	0.508	Q9Y5H9.pdb.gz	PCDA2_HUMAN Protocadherin alpha-2 OS=Homo sapiens OX=9606 GN=PCDHA2 PE=1 SV=1
3	AFDB:Q9Y5I3	0.659	0.697	0.000	950	0.482	0.511	Q9Y5I3.pdb.gz	PCDA1_HUMAN Protocadherin alpha-1 OS=Homo sapiens OX=9606 GN=PCDHA1 PE=2 SV=1
4	AFDB:Q9Y5I4	1.000	1.000	0.000	1007	1.000	1.000	Q9Y5I4.pdb.gz	PCDC2_HUMAN Protocadherin alpha-C2 OS=Homo sapiens OX=9606 GN=PCDHAC2 PE=2 SV=1
5	AFDB:Q91Y13	0.666	0.714	1.194E-103	937	0.466	0.501	Q91Y13.pdb.gz	PCDA7_MOUSE Protocadherin alpha-7 OS=Mus musculus OX=10090 GN=Pcdha7 PE=1 SV=1
6	AFDB:Q9Y5H7	0.662	0.709	2.657E-103	936	0.477	0.513	Q9Y5H7.pdb.gz	PCDA5_HUMAN Protocadherin alpha-5 OS=Homo sapiens OX=9606 GN=PCDHA5 PE=2 SV=1
7	AFDB:Q6ZQD4	0.643	0.672	2.935E-103	962	0.475	0.497	Q6ZQD4.pdb.gz	Q6ZQD4_MOUSE MKIAA0345 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdha3 PE=2 SV=1
8	AFDB:Q9Y5I2	0.620	0.656	3.583E-103	948	0.468	0.497	Q9Y5I2.pdb.gz	PCDAA_HUMAN Protocadherin alpha-10 OS=Homo sapiens OX=9606 GN=PCDHA10 PE=2 SV=1
9	AFDB:Q91Y20	0.660	0.700	9.235E-103	946	0.466	0.496	Q91Y20.pdb.gz	PCDAA_MOUSE Protocadherin alpha-10 OS=Mus musculus OX=10090 GN=Pcdha10 PE=2 SV=1
10	AFDB:O88689	0.615	0.651	6.448E-102	947	0.466	0.495	O88689.pdb.gz	PCDA4_MOUSE Protocadherin alpha-4 OS=Mus musculus OX=10090 GN=Pcdha4 PE=1 SV=1
11	PDB:7sqcO0	0.145	0.131	6.140E-13	1140	0.071	0.062	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4aq1A	0.105	0.137	1.174E-12	721	0.080	0.112	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:6velC	0.170	0.729	1.663E-12	209	0.049	0.234	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
14	PDB:5oj2B	0.129	0.171	2.848E-11	692	0.090	0.132	5oj2B.pdb.gz
15	PDB:4rtdA	0.084	0.077	7.558E-9	1122	0.078	0.070	4rtdA.pdb.gz
16	PDB:6dldD	0.117	0.301	2.902E-8	269	0.036	0.134	6dldD.pdb.gz
17	PDB:5a42A	0.087	0.061	1.928E-7	1597	0.075	0.048	5a42A.pdb.gz
18	PDB:7q1yA	0.106	0.084	4.498E-7	1374	0.056	0.041	7q1yA.pdb.gz
19	PDB:7vonA	0.092	0.072	4.969E-7	1399	0.074	0.054	7vonA.pdb.gz
20	PDB:7q5zA	0.083	0.067	7.782E-7	1344	0.072	0.054	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A6YW27	580	810	0.332	0.412	A0A0A6YW27_MOUSE Protocadherin gamma subfamily A, 1 OS=Mus musculus OX=10090 GN=Pcdhga1 PE=1 SV=1
2	A0A0A6YXT1	634	813	0.352	0.435	A0A0A6YXT1_MOUSE Protocadherin gamma subfamily A, 7 OS=Mus musculus OX=10090 GN=Pcdhga7 PE=1 SV=1
3	A0A2R8QI99	702	997	0.403	0.407	A0A2R8QI99_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=4 SV=1
4	A0PJT6	564	789	0.322	0.411	A0PJT6_MOUSE Protocadherin beta 12 OS=Mus musculus OX=10090 GN=Pcdhb12 PE=2 SV=1
5	B5AK96	551	629	0.310	0.496	B5AK96_MOUSE Protocadherin alpha 2 (Fragment) OS=Mus musculus OX=10090 GN=Pcdha2 PE=2 SV=1
6	B9EJ92	726	902	0.415	0.463	B9EJ92_MOUSE Pcdha2 protein OS=Mus musculus OX=10090 GN=Pcdha2 PE=2 SV=1
7	B9EKB6	713	900	0.405	0.453	B9EKB6_MOUSE Pcdha6 protein OS=Mus musculus OX=10090 GN=Pcdha6 PE=2 SV=1
8	E9PX28	649	1047	0.376	0.362	E9PX28_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
9	E9PXQ7	650	1057	0.376	0.359	E9PXQ7_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
10	I6LBX6	624	931	0.393	0.425	I6LBX6_RAT Protocadherin gamma a9 OS=Rattus norvegicus OX=10116 GN=Pcdhga9 PE=2 SV=1
11	O88192	810	914	0.463	0.510	O88192_MOUSE Cadherin-related neural recepter 5 (Fragment) OS=Mus musculus OX=10090 GN=Pcdha12 PE=2 SV=1
12	O88193	561	898	0.305	0.342	O88193_MOUSE Cadherin-related neural recepter 6 (Fragment) OS=Mus musculus OX=10090 GN=Pcdha5 PE=2 SV=1
13	O88690	807	946	0.472	0.502	O88690_MOUSE CNR2 OS=Mus musculus OX=10090 GN=Pcdha6 PE=2 SV=1
14	Q05C01	798	926	0.449	0.488	Q05C01_MOUSE Pcdha6 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdha2 PE=2 SV=1
15	Q14BM8	559	802	0.317	0.398	Q14BM8_MOUSE Protocadherin beta 16 OS=Mus musculus OX=10090 GN=Pcdhb16 PE=2 SV=1
16	Q3UQY8	548	808	0.302	0.376	Q3UQY8_MOUSE Cadherin domain-containing protein OS=Mus musculus OX=10090 GN=Pcdha11 PE=2 SV=1
17	Q3UTF9	608	874	0.334	0.384	Q3UTF9_MOUSE Cadherin domain-containing protein OS=Mus musculus OX=10090 GN=Pcdhgc4 PE=2 SV=1
18	Q5DTQ9	639	933	0.379	0.409	Q5DTQ9_MOUSE MKIAA0327 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdhga8 PE=2 SV=1
19	Q641K6	702	902	0.402	0.449	Q641K6_MOUSE Pcdha1 protein OS=Mus musculus OX=10090 GN=Pcdha1 PE=2 SV=1
20	Q6DD96	657	935	0.391	0.421	Q6DD96_MOUSE Protocadherin gamma subfamily A, 7 OS=Mus musculus OX=10090 GN=Pcdhga7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	3.2e-79	272.8	Cadherin domain
2	PF08266 Cadherin_2	2.7e-22	89.7	Cadherin-like
3	PF16184 Cadherin_3	0.012	26.9	Cadherin-like
4	PF16492 Cadherin_C_2	7.8e-25	98.7	Cadherin cytoplasmic C-terminal
5	PF15974 Cadherin_tail	7.8e-65	228.9	Cadherin C-terminal cytoplasmic tail, catenin-binding region
6	PF16319 DUF4958	73	12.8	Domain of unknown function (DUF4958)
7	PF03413 PepSY	1.5e+02	14.3	Peptidase propeptide and YPEB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289269

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272198	0.539	Liprin-alpha-4
2	9606.ENSP00000316457	0.503	Uncharacterized protein C20orf197

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	0.928	calcium ion binding
GO:0042802	0.845	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.996	anatomical structure development
GO:0032501	0.995	multicellular organismal process
GO:0009987	0.993	cellular process
GO:0007275	0.950	multicellular organism development
GO:0048731	0.929	system development
GO:0007399	0.901	nervous system development
GO:0007155	0.856	cell adhesion
GO:0050794	0.349	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.985	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]