StarFunc result for job id Q9Y5J3

User Input

>input (304 residues)
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPW
GTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV
LPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE
IGAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5J3	0.999	0.999	1.212E-41	304	1.000	1.000	Q9Y5J3.pdb.gz	HEY1_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Homo sapiens OX=9606 GN=HEY1 PE=1 SV=1
2	AFDB:Q9I8A3	0.662	0.681	5.439E-32	294	0.806	0.833	Q9I8A3.pdb.gz	HEY1_XENLA Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus laevis OX=8355 GN=hey1 PE=1 SV=1
3	AFDB:Q8AXV6	0.465	0.449	8.779E-28	317	0.724	0.694	Q8AXV6.pdb.gz	HEY1_DANRE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Danio rerio OX=7955 GN=hey1 PE=2 SV=1
4	AFDB:G3V7S6	0.467	0.421	1.803E-22	339	0.569	0.510	G3V7S6.pdb.gz	G3V7S6_RAT Hes-related family bHLH transcription factor with YRPW motif 2 OS=Rattus norvegicus OX=10116 GN=Hey2 PE=4 SV=1
5	AFDB:Q9I9L0	0.495	0.469	2.440E-22	324	0.569	0.534	Q9I9L0.pdb.gz	HEY2_DANRE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Danio rerio OX=7955 GN=hey2 PE=2 SV=2
6	AFDB:Q9DBX7	0.397	0.373	1.680E-15	326	0.434	0.405	Q9DBX7.pdb.gz	HEYL_MOUSE Hairy/enhancer-of-split related with YRPW motif-like protein OS=Mus musculus OX=10090 GN=Heyl PE=1 SV=2
7	AFDB:Q9NQ87	0.412	0.384	3.923E-15	328	0.470	0.436	Q9NQ87.pdb.gz	HEYL_HUMAN Hairy/enhancer-of-split related with YRPW motif-like protein OS=Homo sapiens OX=9606 GN=HEYL PE=1 SV=2
8	AFDB:Q7KM13	0.251	0.185	9.715E-14	425	0.411	0.294	Q7KM13.pdb.gz	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1
9	AFDB:A7MCR9	0.252	0.260	1.306E-8	291	0.270	0.282	A7MCR9.pdb.gz
10	AFDB:O57337	0.234	0.240	4.127E-8	290	0.283	0.297	O57337.pdb.gz	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
11	PDB:6o6pA	0.121	0.180	3.215	188	0.062	0.101	6o6pA.pdb.gz	Mycobacterium tuberculosis FasR senses long fatty acyl-CoA through a tunnel and a hydrophobic transmission spine.
12	PDB:7mq8LJ	0.092	0.065	3.628	469	0.069	0.045	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:3vh5A	0.105	0.262	3.855	100	0.053	0.160	3vh5A.pdb.gz
14	PDB:6hivDH	0.130	0.082	3.855	564	0.076	0.041	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:6z6oC	0.106	0.067	3.855	548	0.069	0.038	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
16	PDB:7suk5	0.136	0.139	4.096	296	0.062	0.064	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
17	PDB:1serB	0.135	0.110	5.218	421	0.049	0.036	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
18	PDB:6r1mB	0.125	0.102	5.218	428	0.059	0.042	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
19	PDB:6lo8H	0.127	0.394	5.544	74	0.023	0.095	6lo8H.pdb.gz
20	PDB:2bskD	0.123	0.300	6.258	90	0.062	0.211	2bskD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZYX7	0.0	553	617	0.951	0.468	A0A8I5ZYX7_RAT Hes-related family bHLH transcription factor with YRPW motif 1 OS=Rattus norvegicus OX=10116 GN=Hey1 PE=4 SV=1
2	Q9WV93	0.0	549	299	0.944	0.960	HEY1_MOUSE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Mus musculus OX=10090 GN=Hey1 PE=1 SV=1
3	Q9Y5J3	0.0	613	304	1.000	1.000	HEY1_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Homo sapiens OX=9606 GN=HEY1 PE=1 SV=1
4	Q9I8A3	1.71e-166	466	294	0.809	0.837	HEY1_XENLA Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus laevis OX=8355 GN=hey1 PE=1 SV=1
5	Q8AXV6	7.09e-123	356	317	0.694	0.666	HEY1_DANRE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Danio rerio OX=7955 GN=hey1 PE=2 SV=1
6	Q9UBP5	1.01e-96	290	337	0.586	0.528	HEY2_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Homo sapiens OX=9606 GN=HEY2 PE=1 SV=1
7	G3V7S6	1.22e-94	285	339	0.592	0.531	G3V7S6_RAT Hes-related family bHLH transcription factor with YRPW motif 2 OS=Rattus norvegicus OX=10116 GN=Hey2 PE=4 SV=1
8	Q9QUS4	1.65e-91	277	339	0.582	0.522	HEY2_MOUSE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Mus musculus OX=10090 GN=Hey2 PE=1 SV=1
9	Q9I9L0	8.94e-90	272	324	0.559	0.525	HEY2_DANRE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Danio rerio OX=7955 GN=hey2 PE=2 SV=2
10	Q9NQ87	7.17e-67	214	328	0.365	0.338	HEYL_HUMAN Hairy/enhancer-of-split related with YRPW motif-like protein OS=Homo sapiens OX=9606 GN=HEYL PE=1 SV=2
11	Q9DBX7	8.97e-65	208	326	0.352	0.328	HEYL_MOUSE Hairy/enhancer-of-split related with YRPW motif-like protein OS=Mus musculus OX=10090 GN=Heyl PE=1 SV=2
12	Q7KM13	3.06e-50	173	425	0.270	0.193	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1
13	Q9DF41	1.84e-23	99.4	291	0.289	0.302	Q9DF41_DANRE BHLH-WRPW transcription factor OS=Danio rerio OX=7955 GN=wu:fc30a03 PE=2 SV=1
14	Q7TS99	2.90e-22	95.1	240	0.234	0.296	HELT_MOUSE Hairy and enhancer of split-related protein HELT OS=Mus musculus OX=10090 GN=Helt PE=1 SV=1
15	Q6PBX3	1.09e-21	94.4	270	0.181	0.204	Q6PBX3_DANRE Hairy-related 6 OS=Danio rerio OX=7955 GN=HER-6 PE=2 SV=1
16	Q6XLQ0	1.27e-21	94.4	290	0.191	0.200	Q6XLQ0_CHICK C-hairy1A OS=Gallus gallus OX=9031 GN=hairy1 PE=1 SV=1
17	Q04666	1.47e-21	94.0	281	0.171	0.185	HES1_RAT Transcription factor HES-1 OS=Rattus norvegicus OX=10116 GN=Hes1 PE=1 SV=1
18	Q14469	1.49e-21	94.0	280	0.171	0.186	HES1_HUMAN Transcription factor HES-1 OS=Homo sapiens OX=9606 GN=HES1 PE=1 SV=1
19	P35428	3.01e-21	93.2	282	0.181	0.195	HES1_MOUSE Transcription factor HES-1 OS=Mus musculus OX=10090 GN=Hes1 PE=1 SV=1
20	O57337	3.53e-21	93.2	290	0.191	0.200	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08269 dCache_2	1.4e+02	13.1	Cache domain
2	PF07527 Hairy_orange	1.2e-07	43.2	Hairy Orange
3	PF00010 HLH	1.4e-13	61.9	Helix-loop-helix DNA-binding domain
4	PF13545 HTH_Crp_2	23	16.4	Crp-like helix-turn-helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000020968

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000019021	0.961	Hes-related family bHLH transcription factor with YRPW motif 2
2	9601.ENSPPYP00000001740	0.923	Hes-related family bHLH transcription factor with YRPW motif-like
3	9601.ENSPPYP00000022176	0.889	Notch 1
4	9601.ENSPPYP00000007376	0.864	Transcription factor 12
5	9601.ENSPPYP00000010835	0.861	Notch 3
6	9601.ENSPPYP00000011973	0.860	Delta-like protein
7	9601.ENSPPYP00000020563	0.857	GATA binding protein 4
8	9601.ENSPPYP00000001116	0.852	Uncharacterized protein
9	9601.ENSPPYP00000016373	0.845	Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some NICD product of Notch proteins (Notch intracellular domain), it acts as a transcriptional activator that activates transcription of Notch target genes. Probably represses or activates transcription via the recruitment of chromatin remodeling complexes containing histone deacetylase or histone [...]
10	9601.ENSPPYP00000018437	0.845	Notch 4
11	9601.ENSPPYP00000007046	0.836	Delta-like protein
12	9601.ENSPPYP00000016129	0.807	Hes family bHLH transcription factor 1
13	9601.ENSPPYP00000022269	0.807	Uncharacterized protein
14	9601.ENSPPYP00000024574	0.788	Delta-like protein
15	9601.ENSPPYP00000010467	0.766	Transcription factor 3
16	9601.ENSPPYP00000019254	0.764	Delta-like protein
17	9601.ENSPPYP00000010167	0.759	GATA binding protein 6
18	9601.ENSPPYP00000010306	0.757	Transcription factor 4
19	9601.ENSPPYP00000003961	0.750	Myogenic factor
20	9601.ENSPPYP00000018042	0.746	Mastermind-like 1 (Drosophila)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0140297	0.999	DNA-binding transcription factor binding
GO:1990837	0.997	sequence-specific double-stranded DNA binding
GO:0061629	0.990	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0042802	0.979	identical protein binding
GO:0046983	0.910	protein dimerization activity
GO:0042803	0.711	protein homodimerization activity
GO:0000976	0.596	transcription cis-regulatory region binding
GO:0043425	0.573	bHLH transcription factor binding
GO:0046982	0.544	protein heterodimerization activity
GO:0001227	0.503	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000987	0.447	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.437	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.324	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0007275	0.989	multicellular organism development
GO:0007219	0.985	Notch signaling pathway
GO:0048731	0.981	system development
GO:0006357	0.977	regulation of transcription by RNA polymerase II
GO:0048523	0.976	negative regulation of cellular process
GO:0001837	0.959	epithelial to mesenchymal transition
GO:0048646	0.896	anatomical structure formation involved in morphogenesis
GO:0000122	0.893	negative regulation of transcription by RNA polymerase II
GO:0065009	0.888	regulation of molecular function
GO:0048518	0.871	positive regulation of biological process
GO:0035239	0.845	tube morphogenesis
GO:0072359	0.828	circulatory system development
GO:0048514	0.818	blood vessel morphogenesis
GO:0048522	0.814	positive regulation of cellular process
GO:0061061	0.781	muscle structure development
GO:0010604	0.769	positive regulation of macromolecule metabolic process
GO:0048583	0.737	regulation of response to stimulus
GO:0045944	0.725	positive regulation of transcription by RNA polymerase II
GO:0009887	0.693	animal organ morphogenesis
GO:0045595	0.594	regulation of cell differentiation
GO:0009966	0.592	regulation of signal transduction
GO:0051239	0.591	regulation of multicellular organismal process
GO:0051098	0.575	regulation of binding
GO:0008593	0.540	regulation of Notch signaling pathway
GO:0007507	0.537	heart development
GO:2000026	0.486	regulation of multicellular organismal development
GO:0045597	0.460	positive regulation of cell differentiation
GO:0007399	0.455	nervous system development
GO:0048699	0.453	generation of neurons
GO:0060429	0.444	epithelium development
GO:0001822	0.423	kidney development
GO:0010629	0.419	negative regulation of gene expression
GO:0048729	0.417	tissue morphogenesis
GO:0003007	0.410	heart morphogenesis
GO:0043009	0.334	chordate embryonic development
GO:0009968	0.326	negative regulation of signal transduction
GO:0060317	0.313	cardiac epithelial to mesenchymal transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.979	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]