StarFunc result for job id Q9Y5J5

User Input

>input (127 residues)
MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKA
VECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSL
GTGTLVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5J5	1.000	1.000	6.887E-22	127	1.000	1.000	Q9Y5J5.pdb.gz	PHLA3_HUMAN Pleckstrin homology-like domain family A member 3 OS=Homo sapiens OX=9606 GN=PHLDA3 PE=1 SV=1
2	AFDB:Q9QZA1	0.849	0.272	2.700E-13	407	0.504	0.157	Q9QZA1.pdb.gz	PHLA1_RAT Pleckstrin homology-like domain family A member 1 OS=Rattus norvegicus OX=10116 GN=Phlda1 PE=2 SV=2
3	AFDB:Q53GA4	0.857	0.722	4.186E-13	152	0.480	0.401	Q53GA4.pdb.gz	PHLA2_HUMAN Pleckstrin homology-like domain family A member 2 OS=Homo sapiens OX=9606 GN=PHLDA2 PE=1 SV=2
4	AFDB:Q8WV24	0.821	0.272	8.081E-13	401	0.528	0.167	Q8WV24.pdb.gz	PHLA1_HUMAN Pleckstrin homology-like domain family A member 1 OS=Homo sapiens OX=9606 GN=PHLDA1 PE=1 SV=4
5	AFDB:O08969	0.771	0.685	1.006E-12	144	0.465	0.410	O08969.pdb.gz	PHLA2_MOUSE Pleckstrin homology-like domain family A member 2 OS=Mus musculus OX=10090 GN=Phlda2 PE=1 SV=1
6	AFDB:Q8TD55	0.702	0.203	2.161E-6	490	0.205	0.053	Q8TD55.pdb.gz	PKHO2_HUMAN Pleckstrin homology domain-containing family O member 2 OS=Homo sapiens OX=9606 GN=PLEKHO2 PE=1 SV=1
7	AFDB:Q8K124	0.678	0.194	3.738E-6	495	0.213	0.055	Q8K124.pdb.gz	PKHO2_MOUSE Pleckstrin homology domain-containing family O member 2 OS=Mus musculus OX=10090 GN=Plekho2 PE=1 SV=1
8	PDB:4mk0A	0.618	0.150	9.923E-6	631	0.213	0.043	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
9	AFDB:P32865	0.668	0.149	1.472E-5	700	0.157	0.029	P32865.pdb.gz	GPRK1_DROME G protein-coupled receptor kinase 1 OS=Drosophila melanogaster OX=7227 GN=Gprk1 PE=2 SV=2
10	AFDB:Q09639	0.661	0.145	2.689E-5	707	0.157	0.028	Q09639.pdb.gz	GRK2_CAEEL G protein-coupled receptor kinase 2 OS=Caenorhabditis elegans OX=6239 GN=grk-2 PE=1 SV=2
11	AFDB:P21146	0.615	0.136	3.349E-5	689	0.205	0.038	P21146.pdb.gz	ARBK1_BOVIN Beta-adrenergic receptor kinase 1 OS=Bos taurus OX=9913 GN=GRK2 PE=1 SV=1
12	PDB:3pvuA	0.587	0.146	1.048E-4	609	0.205	0.043	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
13	PDB:3uzsA	0.635	0.152	1.378E-4	609	0.181	0.038	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
14	PDB:3ljuX	0.560	0.216	8.410E-4	373	0.142	0.048	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
15	PDB:4rm8A	0.529	0.208	3.311E-3	368	0.142	0.049	4rm8A.pdb.gz
16	PDB:7c3mA	0.469	0.127	3.311E-3	577	0.197	0.043	7c3mA.pdb.gz
17	PDB:1lw3A	0.586	0.166	3.497E-3	513	0.102	0.025	1lw3A.pdb.gz
18	PDB:6u3eA	0.430	0.165	3.902E-3	397	0.165	0.053	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
19	PDB:6bbpA	0.450	0.135	5.727E-3	520	0.181	0.044	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
20	PDB:5yqrA	0.537	0.280	6.391E-3	268	0.063	0.030	5yqrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y5J5	2.85e-89	256	127	1.000	1.000	PHLA3_HUMAN Pleckstrin homology-like domain family A member 3 OS=Homo sapiens OX=9606 GN=PHLDA3 PE=1 SV=1
2	Q53GA4	1.29e-34	119	152	0.480	0.401	PHLA2_HUMAN Pleckstrin homology-like domain family A member 2 OS=Homo sapiens OX=9606 GN=PHLDA2 PE=1 SV=2
3	R4GND3	2.93e-32	116	260	0.528	0.258	R4GND3_HUMAN Pleckstrin homology like domain family A member 1 OS=Homo sapiens OX=9606 GN=PHLDA1 PE=1 SV=1
4	O08969	5.56e-32	112	144	0.433	0.382	PHLA2_MOUSE Pleckstrin homology-like domain family A member 2 OS=Mus musculus OX=10090 GN=Phlda2 PE=1 SV=1
5	Q9QZA1	1.83e-31	117	407	0.520	0.162	PHLA1_RAT Pleckstrin homology-like domain family A member 1 OS=Rattus norvegicus OX=10116 GN=Phlda1 PE=2 SV=2
6	A2BDE7	2.46e-31	115	312	0.528	0.215	A2BDE7_HUMAN PHLDA1 protein (Fragment) OS=Homo sapiens OX=9606 GN=PHLDA1 PE=1 SV=1
7	Q62392	3.85e-31	116	405	0.528	0.165	PHLA1_MOUSE Pleckstrin homology-like domain family A member 1 OS=Mus musculus OX=10090 GN=Phlda1 PE=1 SV=2
8	Q8WV24	5.16e-30	113	401	0.528	0.167	PHLA1_HUMAN Pleckstrin homology-like domain family A member 1 OS=Homo sapiens OX=9606 GN=PHLDA1 PE=1 SV=4
9	Q9FIT8	0.91	31.2	828	0.157	0.024	AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana OX=3702 GN=AGD1 PE=2 SV=2
10	Q5W7F2	1.2	30.8	827	0.142	0.022	AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana OX=3702 GN=AGD3 PE=1 SV=1
11	Q8K124	1.2	30.8	495	0.213	0.055	PKHO2_MOUSE Pleckstrin homology domain-containing family O member 2 OS=Mus musculus OX=10090 GN=Plekho2 PE=1 SV=1
12	Q9HZ80	1.2	30.8	413	0.205	0.063	Q9HZ80_PSEAE Probable glycosyl transferase WbpJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wbpJ PE=4 SV=1
13	O43739	1.3	30.8	400	0.110	0.035	CYH3_HUMAN Cytohesin-3 OS=Homo sapiens OX=9606 GN=CYTH3 PE=1 SV=2
14	Q15438	1.4	30.8	398	0.110	0.035	CYH1_HUMAN Cytohesin-1 OS=Homo sapiens OX=9606 GN=CYTH1 PE=1 SV=1
15	P97694	1.5	30.4	398	0.110	0.035	CYH1_RAT Cytohesin-1 OS=Rattus norvegicus OX=10116 GN=Cyth1 PE=1 SV=1
16	Q9QX11	1.5	30.4	398	0.110	0.035	CYH1_MOUSE Cytohesin-1 OS=Mus musculus OX=10090 GN=Cyth1 PE=1 SV=2
17	P63034	1.7	30.4	400	0.110	0.035	CYH2_MOUSE Cytohesin-2 OS=Mus musculus OX=10090 GN=Cyth2 PE=1 SV=3
18	P63035	1.7	30.4	400	0.110	0.035	CYH2_RAT Cytohesin-2 OS=Rattus norvegicus OX=10116 GN=Cyth2 PE=1 SV=1
19	Q99418	1.8	30.4	400	0.110	0.035	CYH2_HUMAN Cytohesin-2 OS=Homo sapiens OX=9606 GN=CYTH2 PE=1 SV=2
20	Q8RQE8	2.3	30.0	1524	0.165	0.014	RPOC_THET8 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=rpoC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	0.14	24.0	PH domain
2	PF20399 PH_20	7e+02	11.7	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010377172.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010369001.1	0.612	Integrin subunit beta 3 binding protein
2	61622.XP_010377174.1	0.576	Anchoring filament protein which is a component of the basement membrane zone
3	61622.XP_010387128.1	0.576	KN motif and ankyrin repeat domains 3
4	61622.XP_010360689.1	0.573	Acts as a tumor suppressor in many tumor types
5	61622.XP_010360602.1	0.551	Apoptosis enhancing nuclease
6	61622.XP_010362118.1	0.541	Ribonuclease H2 subunit B isoform X1
7	61622.XP_010374002.1	0.541	Ral GEF with PH domain and SH3 binding motif 2
8	61622.XP_010367252.1	0.515	Procollagen galactosyltransferase 2
9	61622.XP_010372291.1	0.500	Zinc finger matrin-type protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043168	0.999	anion binding
GO:1901981	0.996	phosphatidylinositol phosphate binding
GO:0005547	0.993	phosphatidylinositol-3,4,5-trisphosphate binding
GO:0080025	0.992	phosphatidylinositol-3,5-bisphosphate binding
GO:0043325	0.991	phosphatidylinositol-3,4-bisphosphate binding
GO:0032266	0.991	phosphatidylinositol-3-phosphate binding
GO:0010314	0.991	phosphatidylinositol-5-phosphate binding
GO:0005546	0.991	phosphatidylinositol-4,5-bisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0035556	0.988	intracellular signal transduction
GO:0023051	0.987	regulation of signaling
GO:0010646	0.987	regulation of cell communication
GO:0033554	0.987	cellular response to stress
GO:0009966	0.980	regulation of signal transduction
GO:0048518	0.975	positive regulation of biological process
GO:0006974	0.975	cellular response to DNA damage stimulus
GO:0048522	0.963	positive regulation of cellular process
GO:0072331	0.939	signal transduction by p53 class mediator
GO:0097190	0.927	apoptotic signaling pathway
GO:0048523	0.918	negative regulation of cellular process
GO:1902531	0.907	regulation of intracellular signal transduction
GO:0097193	0.905	intrinsic apoptotic signaling pathway
GO:0009968	0.882	negative regulation of signal transduction
GO:0010941	0.873	regulation of cell death
GO:0008630	0.827	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0042771	0.766	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0010942	0.679	positive regulation of cell death
GO:1902532	0.679	negative regulation of intracellular signal transduction
GO:0051896	0.672	regulation of protein kinase B signaling
GO:0051898	0.538	negative regulation of protein kinase B signaling
GO:0043067	0.512	regulation of programmed cell death
GO:0042981	0.461	regulation of apoptotic process
GO:0019222	0.433	regulation of metabolic process
GO:0032502	0.419	developmental process
GO:0048856	0.404	anatomical structure development
GO:0080090	0.355	regulation of primary metabolic process
GO:0008152	0.336	metabolic process
GO:0043068	0.309	positive regulation of programmed cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005886	0.987	plasma membrane
GO:0005622	0.894	intracellular anatomical structure
GO:0005737	0.835	cytoplasm
GO:0070013	0.314	intracellular organelle lumen
GO:0043227	0.306	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]