StarFunc result for job id Q9Y5J6

User Input

>input (103 residues)
MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSN
HRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5J6	1.000	1.000	1.528E-15	103	1.000	1.000	Q9Y5J6.pdb.gz	T10B_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 B OS=Homo sapiens OX=9606 GN=TIMM10B PE=1 SV=1
2	PDB:7cgpJ	0.725	0.886	8.073E-11	83	0.786	0.976	7cgpJ.pdb.gz
3	AFDB:Q9Y0V3	0.616	0.549	1.341E-4	117	0.282	0.248	Q9Y0V3.pdb.gz	T10B_DROME Mitochondrial import inner membrane translocase subunit Tim10B OS=Drosophila melanogaster OX=7227 GN=Tim9b PE=3 SV=1
4	AFDB:Q9Y0V2	0.590	0.551	2.866E-4	111	0.233	0.216	Q9Y0V2.pdb.gz	T10B_CAEEL Mitochondrial import inner membrane translocase subunit Tim10B OS=Caenorhabditis elegans OX=6239 GN=tin-9.2 PE=3 SV=1
5	PDB:2bskC	0.547	0.695	8.972E-4	79	0.204	0.266	2bskC.pdb.gz
6	AFDB:Q17754	0.648	0.734	1.064E-3	90	0.223	0.256	Q17754.pdb.gz	TIM9_CAEEL Mitochondrial import inner membrane translocase subunit Tim9 OS=Caenorhabditis elegans OX=6239 GN=tin-9.1 PE=3 SV=1
7	AFDB:O74700	0.669	0.782	1.402E-3	87	0.175	0.207	O74700.pdb.gz	TIM9_YEAST Mitochondrial import inner membrane translocase subunit TIM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM9 PE=1 SV=1
8	AFDB:Q6FRT3	0.674	0.790	1.981E-3	87	0.184	0.218	Q6FRT3.pdb.gz	TIM9_CANGA Mitochondrial import inner membrane translocase subunit TIM9 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TIM9 PE=3 SV=1
9	AFDB:P62072	0.636	0.717	2.797E-3	90	0.223	0.256	P62072.pdb.gz	TIM10_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1
10	AFDB:A0A024R648	0.611	0.700	3.211E-3	89	0.194	0.225	A0A024R648.pdb.gz
11	AFDB:K7EIT2	0.503	0.633	5.579E-3	80	0.175	0.225	K7EIT2.pdb.gz	K7EIT2_HUMAN Mitochondrial import inner membrane translocase subunit OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1
12	AFDB:P32830	0.505	0.479	5.978E-3	109	0.184	0.174	P32830.pdb.gz	TIM12_YEAST Mitochondrial import inner membrane translocase subunit TIM12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM12 PE=1 SV=1
13	PDB:6lo8E	0.598	0.751	7.118E-3	80	0.175	0.225	6lo8E.pdb.gz
14	PDB:6lo8H	0.567	0.767	1.236E-2	74	0.146	0.203	6lo8H.pdb.gz
15	PDB:2bskD	0.619	0.699	2.302E-2	90	0.214	0.244	2bskD.pdb.gz
16	PDB:6lo8F	0.502	0.606	2.642E-2	84	0.146	0.179	6lo8F.pdb.gz
17	PDB:6wjv4	0.171	0.165	2.889	107	0.155	0.150	6wjv4.pdb.gz
18	PDB:6mj2A	0.289	0.030	3.317	1337	0.146	0.011	6mj2A.pdb.gz	Structures and gating mechanism of human TRPM2.
19	PDB:5mpbV	0.221	0.102	3.554	289	0.068	0.024	5mpbV.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
20	PDB:6o3sA	0.272	0.522	3.554	47	0.087	0.191	6o3sA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y5J6	2.71e-72	211	103	1.000	1.000	T10B_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 B OS=Homo sapiens OX=9606 GN=TIMM10B PE=1 SV=1
2	Q9WV96	6.64e-59	177	100	0.835	0.860	T10B_MOUSE Mitochondrial import inner membrane translocase subunit Tim10 B OS=Mus musculus OX=10090 GN=Timm10b PE=1 SV=1
3	Q9Y0V3	2.56e-16	70.5	117	0.282	0.248	T10B_DROME Mitochondrial import inner membrane translocase subunit Tim10B OS=Drosophila melanogaster OX=7227 GN=Tim9b PE=3 SV=1
4	Q9Y0V2	1.79e-08	50.1	111	0.291	0.270	T10B_CAEEL Mitochondrial import inner membrane translocase subunit Tim10B OS=Caenorhabditis elegans OX=6239 GN=tin-9.2 PE=3 SV=1
5	Q17754	3.71e-08	48.9	90	0.184	0.211	TIM9_CAEEL Mitochondrial import inner membrane translocase subunit Tim9 OS=Caenorhabditis elegans OX=6239 GN=tin-9.1 PE=3 SV=1
6	Q9XGX9	2.82e-07	46.6	93	0.204	0.226	TIM9_ARATH Mitochondrial import inner membrane translocase subunit TIM9 OS=Arabidopsis thaliana OX=3702 GN=TIM9 PE=1 SV=2
7	Q9Y5J7	7.11e-07	45.4	89	0.175	0.202	TIM9_HUMAN Mitochondrial import inner membrane translocase subunit Tim9 OS=Homo sapiens OX=9606 GN=TIMM9 PE=1 SV=1
8	Q6FRT3	1.00e-06	45.1	87	0.214	0.253	TIM9_CANGA Mitochondrial import inner membrane translocase subunit TIM9 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TIM9 PE=3 SV=1
9	Q9WV98	1.20e-06	45.1	89	0.175	0.202	TIM9_MOUSE Mitochondrial import inner membrane translocase subunit Tim9 OS=Mus musculus OX=10090 GN=Timm9 PE=1 SV=1
10	P57744	6.82e-06	42.7	87	0.136	0.161	TIM8_YEAST Mitochondrial import inner membrane translocase subunit TIM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM8 PE=1 SV=1
11	O74700	1.57e-05	42.0	87	0.194	0.230	TIM9_YEAST Mitochondrial import inner membrane translocase subunit TIM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM9 PE=1 SV=1
12	P62072	0.003	36.2	90	0.175	0.200	TIM10_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1
13	P62073	0.003	36.2	90	0.175	0.200	TIM10_MOUSE Mitochondrial import inner membrane translocase subunit Tim10 OS=Mus musculus OX=10090 GN=Timm10 PE=1 SV=1
14	Q9Y5J9	0.008	34.7	83	0.146	0.181	TIM8B_HUMAN Mitochondrial import inner membrane translocase subunit Tim8 B OS=Homo sapiens OX=9606 GN=TIMM8B PE=1 SV=1
15	Q4FZG7	0.014	34.3	97	0.194	0.206	TI8AB_MOUSE Putative mitochondrial import inner membrane translocase subunit Tim8 A-B OS=Mus musculus OX=10090 GN=Timm8a2 PE=3 SV=1
16	P62077	0.018	33.9	83	0.146	0.181	TIM8B_MOUSE Mitochondrial import inner membrane translocase subunit Tim8 B OS=Mus musculus OX=10090 GN=Timm8b PE=1 SV=1
17	P32830	0.023	33.9	109	0.146	0.138	TIM12_YEAST Mitochondrial import inner membrane translocase subunit TIM12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM12 PE=1 SV=1
18	Q9W2D6	0.047	33.1	92	0.155	0.174	TIM10_DROME Mitochondrial import inner membrane translocase subunit Tim10 OS=Drosophila melanogaster OX=7227 GN=Tim10 PE=3 SV=1
19	O60220	0.049	33.1	97	0.184	0.196	TIM8A_HUMAN Mitochondrial import inner membrane translocase subunit Tim8 A OS=Homo sapiens OX=9606 GN=TIMM8A PE=1 SV=1
20	Q9WVA1	0.066	32.7	97	0.184	0.196	TIM8A_RAT Mitochondrial import inner membrane translocase subunit Tim8 A OS=Rattus norvegicus OX=10116 GN=Timm8a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02953 zf-Tim10_DDP	2.1e-11	54.5	Tim10/DDP family zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254616

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257245	0.999	Mitochondrial import inner membrane translocase subunit Tim10
2	9606.ENSP00000320236	0.997	Mitochondrial import inner membrane translocase subunit Tim22
3	9606.ENSP00000270502	0.996	Mitochondrial import inner membrane translocase subunit Tim29
4	9606.ENSP00000378588	0.990	Mitochondrial import inner membrane translocase subunit Tim9
5	9606.ENSP00000347581	0.989	Acylglycerol kinase, mitochondrial
6	9606.ENSP00000215570	0.987	Mitochondrial import inner membrane translocase subunit Tim13
7	9606.ENSP00000438455	0.959	Mitochondrial import inner membrane translocase subunit Tim8 B
8	9606.ENSP00000361993	0.942	Mitochondrial import inner membrane translocase subunit Tim8 A
9	9606.ENSP00000356256	0.901	Mitochondrial import inner membrane translocase subunit Tim17-A
10	9606.ENSP00000295767	0.895	Mitochondrial intermembrane space import and assembly protein 40
11	9606.ENSP00000379999	0.876	Translocase of inner mitochondrial membrane 17B
12	9606.ENSP00000464522	0.870	Mitochondrial import inner membrane translocase subunit Tim23
13	9606.ENSP00000281456	0.809	ADP/ATP translocase 1
14	9606.ENSP00000370808	0.793	ADP/ATP translocase 3
15	9606.ENSP00000351214	0.787	Mitochondrial import receptor subunit TOM7 homolog
16	9606.ENSP00000364699	0.751	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
17	9606.ENSP00000445806	0.721	Mitochondrial import inner membrane translocase subunit TIM50
18	9606.ENSP00000270538	0.679	Mitochondrial import inner membrane translocase subunit TIM44
19	9606.ENSP00000169551	0.674	Mitochondrial import inner membrane translocase subunit Tim21
20	9606.ENSP00000388337	0.674	Protein transport protein Sec61 subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0007160	0.847	cell-matrix adhesion
GO:0016043	0.447	cellular component organization
GO:0007005	0.320	mitochondrion organization
GO:0006810	0.318	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0032991	0.982	protein-containing complex
GO:0016020	0.978	membrane
GO:0031090	0.917	organelle membrane
GO:0005743	0.899	mitochondrial inner membrane
GO:0098796	0.885	membrane protein complex
GO:0098798	0.874	mitochondrial protein-containing complex
GO:0098800	0.833	inner mitochondrial membrane protein complex
GO:1990351	0.734	transporter complex
GO:0005758	0.728	mitochondrial intermembrane space
GO:0042719	0.511	mitochondrial intermembrane space protein transporter complex
GO:0042721	0.421	TIM22 mitochondrial import inner membrane insertion complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]