StarFunc result for job id Q9Y5J7

User Input

>input (89 residues)
MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMT
QRISMRFQEYHIQQNEALAAKAGLLGQPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R648	0.932	0.932	3.853E-13	89	1.000	1.000	A0A024R648.pdb.gz
2	PDB:2bskC	0.751	0.839	1.571E-10	79	0.876	0.987	2bskC.pdb.gz
3	AFDB:Q17754	0.827	0.818	2.478E-5	90	0.360	0.356	Q17754.pdb.gz	TIM9_CAEEL Mitochondrial import inner membrane translocase subunit Tim9 OS=Caenorhabditis elegans OX=6239 GN=tin-9.1 PE=3 SV=1
4	AFDB:O74700	0.645	0.657	5.019E-4	87	0.404	0.414	O74700.pdb.gz	TIM9_YEAST Mitochondrial import inner membrane translocase subunit TIM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM9 PE=1 SV=1
5	AFDB:Q6FRT3	0.680	0.695	7.714E-4	87	0.371	0.379	Q6FRT3.pdb.gz	TIM9_CANGA Mitochondrial import inner membrane translocase subunit TIM9 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TIM9 PE=3 SV=1
6	AFDB:Q9Y0V2	0.656	0.532	1.027E-3	111	0.258	0.207	Q9Y0V2.pdb.gz	T10B_CAEEL Mitochondrial import inner membrane translocase subunit Tim10B OS=Caenorhabditis elegans OX=6239 GN=tin-9.2 PE=3 SV=1
7	PDB:6lo8E	0.643	0.710	2.244E-3	80	0.337	0.375	6lo8E.pdb.gz
8	AFDB:Q9Y5J6	0.706	0.621	2.427E-3	103	0.258	0.223	Q9Y5J6.pdb.gz	T10B_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 B OS=Homo sapiens OX=9606 GN=TIMM10B PE=1 SV=1
9	AFDB:P62072	0.689	0.683	2.607E-3	90	0.236	0.233	P62072.pdb.gz	TIM10_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1
10	AFDB:Q9XGX9	0.662	0.634	3.232E-3	93	0.337	0.323	Q9XGX9.pdb.gz	TIM9_ARATH Mitochondrial import inner membrane translocase subunit TIM9 OS=Arabidopsis thaliana OX=3702 GN=TIM9 PE=1 SV=2
11	PDB:7cgpJ	0.698	0.744	4.276E-3	83	0.236	0.253	7cgpJ.pdb.gz
12	AFDB:Q9Y0V3	0.572	0.438	6.158E-3	117	0.236	0.179	Q9Y0V3.pdb.gz	T10B_DROME Mitochondrial import inner membrane translocase subunit Tim10B OS=Drosophila melanogaster OX=7227 GN=Tim9b PE=3 SV=1
13	AFDB:Q57XQ4	0.666	0.747	7.634E-3	78	0.191	0.218	Q57XQ4.pdb.gz	Q57XQ4_TRYB2 Mitochondrial import inner membrane translocase subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.130 PE=3 SV=1
14	PDB:2bskD	0.682	0.675	1.668E-2	90	0.202	0.200	2bskD.pdb.gz
15	PDB:6lo8H	0.572	0.674	8.662E-2	74	0.169	0.203	6lo8H.pdb.gz
16	PDB:6lo8F	0.652	0.687	1.905E-1	84	0.169	0.179	6lo8F.pdb.gz
17	PDB:7lbmo	0.421	0.359	3.591	108	0.157	0.130	7lbmo.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
18	PDB:5c0wL	0.358	0.296	4.452	113	0.124	0.097	5c0wL.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
19	PDB:6rq7B	0.315	0.085	5.138	479	0.135	0.025	6rq7B.pdb.gz	Controlled dehydration, structural flexibility and gadolinium MRI contrast compound binding in the human plasma glycoprotein afamin.
20	PDB:6oxdA	0.195	0.028	5.519	736	0.056	0.007	6oxdA.pdb.gz	Itaconyl-CoA forms a stable biradical in methylmalonyl-CoA mutase and derails its activity and repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y5J7	7.82e-63	186	89	1.000	1.000	TIM9_HUMAN Mitochondrial import inner membrane translocase subunit Tim9 OS=Homo sapiens OX=9606 GN=TIMM9 PE=1 SV=1
2	Q9WV98	1.26e-61	183	89	0.978	0.978	TIM9_MOUSE Mitochondrial import inner membrane translocase subunit Tim9 OS=Mus musculus OX=10090 GN=Timm9 PE=1 SV=1
3	Q17754	4.62e-18	73.6	90	0.360	0.356	TIM9_CAEEL Mitochondrial import inner membrane translocase subunit Tim9 OS=Caenorhabditis elegans OX=6239 GN=tin-9.1 PE=3 SV=1
4	O74700	4.77e-15	65.9	87	0.371	0.379	TIM9_YEAST Mitochondrial import inner membrane translocase subunit TIM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM9 PE=1 SV=1
5	Q9XGX9	3.46e-14	63.9	93	0.337	0.323	TIM9_ARATH Mitochondrial import inner membrane translocase subunit TIM9 OS=Arabidopsis thaliana OX=3702 GN=TIM9 PE=1 SV=2
6	Q6FRT3	4.46e-14	63.5	87	0.348	0.356	TIM9_CANGA Mitochondrial import inner membrane translocase subunit TIM9 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TIM9 PE=3 SV=1
7	Q9Y0V2	1.54e-09	52.4	111	0.247	0.198	T10B_CAEEL Mitochondrial import inner membrane translocase subunit Tim10B OS=Caenorhabditis elegans OX=6239 GN=tin-9.2 PE=3 SV=1
8	Q9Y0V3	4.67e-07	46.2	117	0.191	0.145	T10B_DROME Mitochondrial import inner membrane translocase subunit Tim10B OS=Drosophila melanogaster OX=7227 GN=Tim9b PE=3 SV=1
9	Q9Y5J6	2.81e-06	43.9	103	0.191	0.165	T10B_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 B OS=Homo sapiens OX=9606 GN=TIMM10B PE=1 SV=1
10	Q9WV96	3.09e-06	43.5	100	0.191	0.170	T10B_MOUSE Mitochondrial import inner membrane translocase subunit Tim10 B OS=Mus musculus OX=10090 GN=Timm10b PE=1 SV=1
11	P62072	5.54e-04	37.7	90	0.191	0.189	TIM10_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1
12	P62073	5.54e-04	37.7	90	0.191	0.189	TIM10_MOUSE Mitochondrial import inner membrane translocase subunit Tim10 OS=Mus musculus OX=10090 GN=Timm10 PE=1 SV=1
13	Q9W2D6	0.008	34.7	92	0.225	0.217	TIM10_DROME Mitochondrial import inner membrane translocase subunit Tim10 OS=Drosophila melanogaster OX=7227 GN=Tim10 PE=3 SV=1
14	Q57XQ4	0.017	33.5	78	0.157	0.179	Q57XQ4_TRYB2 Mitochondrial import inner membrane translocase subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.130 PE=3 SV=1
15	P87108	0.031	33.1	93	0.135	0.129	TIM10_YEAST Mitochondrial import inner membrane translocase subunit TIM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM10 PE=1 SV=1
16	Q9XGY4	0.19	30.8	77	0.157	0.182	TIM8_ARATH Mitochondrial import inner membrane translocase subunit TIM8 OS=Arabidopsis thaliana OX=3702 GN=TIM8 PE=1 SV=1
17	Q9Y0V6	0.32	30.4	86	0.146	0.151	TIM10_CAEEL Mitochondrial import inner membrane translocase subunit Tim10 OS=Caenorhabditis elegans OX=6239 GN=tin-10 PE=3 SV=1
18	P53299	0.61	29.6	105	0.169	0.143	TIM13_YEAST Mitochondrial import inner membrane translocase subunit TIM13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM13 PE=1 SV=1
19	A7M6E8	0.76	30.0	754	0.180	0.021	TM1S_SOLLC ToMV susceptible protein tm-1(GCR26) OS=Solanum lycopersicum OX=4081 GN=tm-1 PE=1 SV=1
20	F4IKQ3	1.5	28.9	107	0.146	0.121	F4IKQ3_ARATH Mitochondrial import inner membrane translocase subunit OS=Arabidopsis thaliana OX=3702 GN=TIM10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09889 DUF2116	32	15.9	Uncharacterized protein containing a Zn-ribbon (DUF2116)
2	PF02953 zf-Tim10_DDP	3.9e-13	60.1	Tim10/DDP family zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 225400.XP_006767730.1

Rank	PPI partner	STRING score	Description
1	225400.XP_006754188.1	0.999	Mitochondrial import inner membrane translocase subunit Tim13
2	225400.XP_006772118.1	0.999	Mitochondrial import inner membrane translocase subunit Tim10
3	225400.XP_006768137.1	0.994	Mitochondrial import inner membrane translocase subunit Tim22
4	225400.XP_006764340.1	0.991	Mitochondrial import inner membrane translocase subunit Tim8 A
5	225400.XP_006770105.1	0.982	Mitochondrial import inner membrane translocase subunit Tim9 B
6	225400.XP_006761579.1	0.951	Translocase of inner mitochondrial membrane 8 homolog B
7	225400.XP_006758393.1	0.915	Mitochondrial intermembrane space import and assembly protein 40
8	225400.XP_006776569.1	0.915	Mitochondrial intermembrane space import and assembly protein 40-like
9	225400.XP_006777151.1	0.892	Acylglycerol kinase, mitochondrial isoform X1
10	225400.XP_006757200.1	0.881	Mitochondrial import inner membrane translocase subunit Tim23
11	225400.XP_006765891.1	0.881	Translocase of inner mitochondrial membrane 29
12	225400.XP_006757528.1	0.868	Mitochondrial import inner membrane translocase subunit Tim17-A
13	225400.XP_006779091.1	0.847	Translocase of outer mitochondrial membrane 7
14	225400.XP_006764927.1	0.836	Protein transport protein Sec61 subunit gamma
15	225400.XP_006752783.1	0.819	Mitochondrial import inner membrane translocase subunit TIM44
16	225400.XP_006779627.1	0.801	Growth factor, augmenter of liver regeneration
17	225400.XP_006763238.1	0.798	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
18	225400.XP_006760899.1	0.794	Neural precursor cell expressed, developmentally down-regulated 8
19	225400.XP_006761580.1	0.792	Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q)
20	225400.XP_006769768.1	0.792	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	0.998	protein homodimerization activity
GO:0008270	0.998	zinc ion binding
GO:0051087	0.997	chaperone binding
GO:0032977	0.997	membrane insertase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.995	cellular component organization
GO:0051204	0.992	protein insertion into mitochondrial membrane
GO:0006605	0.991	protein targeting
GO:0007007	0.981	inner mitochondrial membrane organization
GO:0006626	0.978	protein targeting to mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0070013	0.998	intracellular organelle lumen
GO:0005740	0.997	mitochondrial envelope
GO:0016020	0.979	membrane
GO:0031970	0.946	organelle envelope lumen
GO:0031090	0.938	organelle membrane
GO:0005758	0.931	mitochondrial intermembrane space
GO:0031966	0.891	mitochondrial membrane
GO:0005743	0.884	mitochondrial inner membrane
GO:0098798	0.811	mitochondrial protein-containing complex
GO:1990351	0.682	transporter complex
GO:0098796	0.671	membrane protein complex
GO:0098800	0.584	inner mitochondrial membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]