StarFunc result for job id Q9Y5K5

User Input

>input (329 residues)
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELL
KTLAEHQQLIPLVEKAKEKQNAKKAQETK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5LJA9	0.987	0.883	1.029E-59	368	1.000	0.894	Q5LJA9.pdb.gz	Q5LJA9_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=UCHL5 PE=1 SV=1
2	AFDB:Q9WUP7	0.959	0.959	1.589E-58	329	0.970	0.970	Q9WUP7.pdb.gz	UCHL5_MOUSE Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Mus musculus OX=10090 GN=Uchl5 PE=1 SV=2
3	AFDB:A0A2R8QDN8	0.957	0.957	5.335E-56	329	0.891	0.891	A0A2R8QDN8.pdb.gz
4	PDB:4uelA	0.894	0.973	7.861E-52	302	0.915	0.997	4uelA.pdb.gz
5	AFDB:A0A0G2K2A5	0.868	0.841	1.678E-50	340	0.903	0.874	A0A0G2K2A5.pdb.gz	A0A0G2K2A5_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Uchl5 PE=1 SV=2
6	AFDB:Q9XZ61	0.912	0.926	1.891E-45	324	0.599	0.608	Q9XZ61.pdb.gz	Q9XZ61_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Uch-L5 PE=1 SV=1
7	AFDB:O04482	0.882	0.879	9.852E-37	330	0.477	0.476	O04482.pdb.gz	UCH2_ARATH Ubiquitin carboxyl-terminal hydrolase 2 OS=Arabidopsis thaliana OX=3702 GN=UCH2 PE=1 SV=1
8	AFDB:Q9FFF2	0.865	0.853	3.706E-34	334	0.407	0.401	Q9FFF2.pdb.gz	UCH1_ARATH Ubiquitin carboxyl-terminal hydrolase OS=Arabidopsis thaliana OX=3702 GN=UCH1 PE=1 SV=1
9	AFDB:Q09444	0.858	0.878	5.525E-34	321	0.453	0.464	Q09444.pdb.gz	UBH4_CAEEL Ubiquitin carboxyl-terminal hydrolase ubh-4 OS=Caenorhabditis elegans OX=6239 GN=ubh-4 PE=1 SV=2
10	AFDB:Q9UUB6	0.807	0.882	2.200E-31	300	0.374	0.410	Q9UUB6.pdb.gz	UBLH2_SCHPO Ubiquitin carboxyl-terminal hydrolase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uch2 PE=1 SV=1
11	AFDB:Q385Q4	0.790	0.837	2.230E-29	309	0.377	0.401	Q385Q4.pdb.gz	Q385Q4_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2800 PE=3 SV=1
12	PDB:1xd3A	0.554	0.782	1.260E-15	229	0.191	0.275	1xd3A.pdb.gz	Structure of the Ubiquitin Hydrolase UCH-L3 Complexed with a Suicide Substrate
13	PDB:1uchA	0.512	0.800	2.900E-14	206	0.170	0.272	1uchA.pdb.gz
14	PDB:2we6A	0.541	0.831	3.857E-14	208	0.143	0.226	2we6A.pdb.gz
15	PDB:2lenA	0.508	0.701	5.087E-11	231	0.149	0.212	2lenA.pdb.gz
16	PDB:7en4A	0.533	0.714	1.783E-10	236	0.182	0.254	7en4A.pdb.gz
17	PDB:6pgvA	0.150	0.314	2.417E-3	152	0.040	0.086	6pgvA.pdb.gz	Structural insights into the activity and regulation of human Josephin-2
18	PDB:7krwA	0.112	0.065	3.652E-1	608	0.043	0.023	7krwA.pdb.gz	Conformational equilibria in allosteric control of Hsp70 chaperones.
19	PDB:7naoD	0.173	0.216	6.101E-1	241	0.079	0.108	7naoD.pdb.gz
20	PDB:7nvrk	0.130	0.285	7.239E-1	133	0.046	0.113	7nvrk.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K2A5	0.0	599	331	0.903	0.897	A0A0G2K2A5_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Uchl5 PE=1 SV=2
2	A0A8I6GL10	0.0	672	329	0.976	0.976	A0A8I6GL10_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Uchl5 PE=3 SV=1
3	Q5HZY3	0.0	644	324	0.933	0.948	Q5HZY3_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Uchl5 PE=1 SV=1
4	Q5LJA5	0.0	659	355	0.997	0.924	Q5LJA5_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=UCHL5 PE=1 SV=1
5	Q5LJA9	0.0	666	368	1.000	0.894	Q5LJA9_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=UCHL5 PE=1 SV=1
6	Q5LJB0	0.0	502	258	0.739	0.942	Q5LJB0_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=UCHL5 PE=1 SV=1
7	Q6NWL6	0.0	616	329	0.888	0.888	Q6NWL6_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=wu:fj17f09 PE=1 SV=1
8	Q9WUP7	0.0	668	329	0.970	0.970	UCHL5_MOUSE Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Mus musculus OX=10090 GN=Uchl5 PE=1 SV=2
9	Q9XSJ0	0.0	671	328	0.985	0.988	UCHL5_BOVIN Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Bos taurus OX=9913 GN=UCHL5 PE=2 SV=1
10	Q9Y5K5	0.0	684	329	1.000	1.000	UCHL5_HUMAN Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Homo sapiens OX=9606 GN=UCHL5 PE=1 SV=3
11	H0Y6Y4	4.31e-150	422	218	0.623	0.940	H0Y6Y4_HUMAN ubiquitinyl hydrolase 1 (Fragment) OS=Homo sapiens OX=9606 GN=UCHL5 PE=1 SV=1
12	Q9XZ61	6.79e-143	408	324	0.605	0.614	Q9XZ61_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Uch-L5 PE=1 SV=1
13	O04482	3.69e-105	312	330	0.480	0.479	UCH2_ARATH Ubiquitin carboxyl-terminal hydrolase 2 OS=Arabidopsis thaliana OX=3702 GN=UCH2 PE=1 SV=1
14	Q09444	1.26e-98	295	321	0.450	0.461	UBH4_CAEEL Ubiquitin carboxyl-terminal hydrolase ubh-4 OS=Caenorhabditis elegans OX=6239 GN=ubh-4 PE=1 SV=2
15	Q9FFF2	2.36e-86	265	334	0.429	0.422	UCH1_ARATH Ubiquitin carboxyl-terminal hydrolase OS=Arabidopsis thaliana OX=3702 GN=UCH1 PE=1 SV=1
16	Q9UUB6	4.48e-70	222	300	0.386	0.423	UBLH2_SCHPO Ubiquitin carboxyl-terminal hydrolase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uch2 PE=1 SV=1
17	Q385Q4	4.16e-67	214	309	0.392	0.417	Q385Q4_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2800 PE=3 SV=1
18	Q7K5N4	3.23e-59	199	471	0.374	0.261	CALYP_DROME Ubiquitin carboxyl-terminal hydrolase calypso OS=Drosophila melanogaster OX=7227 GN=caly PE=1 SV=1
19	Q99PU7	6.59e-57	197	728	0.334	0.151	BAP1_MOUSE Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Mus musculus OX=10090 GN=Bap1 PE=1 SV=1
20	Q92560	1.01e-56	197	729	0.334	0.151	BAP1_HUMAN Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Homo sapiens OX=9606 GN=BAP1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01088 Peptidase_C12	1.5e-66	235.7	Ubiquitin carboxyl-terminal hydrolase, family 1
2	PF18031 UCH_C	4.7e-16	69.7	Ubiquitin carboxyl-terminal hydrolases

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9986.ENSOCUP00000014412

Rank	PPI partner	STRING score	Description
1	9986.ENSOCUP00000001221	0.997	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
2	9986.ENSOCUP00000004455	0.994	Oryctolagus cuniculus proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 (PSMD4), mRNA
3	9986.ENSOCUP00000003233	0.989	Nuclear factor related to kappaB binding protein
4	9986.ENSOCUP00000023048	0.987	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
5	9986.ENSOCUP00000018745	0.986	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3
6	9986.ENSOCUP00000015687	0.985	Ubiquitin carboxyl-terminal hydrolase 14
7	9986.ENSOCUP00000023812	0.984	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
8	9986.ENSOCUP00000006105	0.983	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
9	9986.ENSOCUP00000007557	0.981	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
10	9986.ENSOCUP00000010880	0.981	Proteasome (prosome, macropain) 26S subunit, ATPase, 6
11	9986.ENSOCUP00000007407	0.980	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
12	9986.ENSOCUP00000011967	0.980	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
13	9986.ENSOCUP00000007344	0.977	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 11
14	9986.ENSOCUP00000014186	0.975	RuvB-like helicase
15	9986.ENSOCUP00000017910	0.971	Proteasome (prosome, macropain) 26S subunit, ATPase, 3
16	9986.ENSOCUP00000005555	0.967	RuvB-like helicase
17	9986.ENSOCUP00000002241	0.964	Proteasome (prosome, macropain) subunit, beta type, 3
18	9986.ENSOCUP00000011410	0.964	Proteasome (prosome, macropain) subunit, alpha type, 4
19	9986.ENSOCUP00000020661	0.964	Proteasome (prosome, macropain) 26S subunit, ATPase, 4
20	9986.ENSOCUP00000003977	0.961	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	0.999	cysteine-type deubiquitinase activity
GO:0005488	0.998	binding
GO:0005515	0.967	protein binding
GO:0070628	0.872	proteasome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.954	cellular process
GO:0071704	0.939	organic substance metabolic process
GO:0044238	0.924	primary metabolic process
GO:0043170	0.915	macromolecule metabolic process
GO:0006807	0.906	nitrogen compound metabolic process
GO:0050789	0.855	regulation of biological process
GO:0006508	0.798	proteolysis
GO:0050794	0.792	regulation of cellular process
GO:0060255	0.686	regulation of macromolecule metabolic process
GO:0048522	0.683	positive regulation of cellular process
GO:0051171	0.605	regulation of nitrogen compound metabolic process
GO:0080090	0.604	regulation of primary metabolic process
GO:0043412	0.601	macromolecule modification
GO:0031323	0.599	regulation of cellular metabolic process
GO:0044237	0.590	cellular metabolic process
GO:0010604	0.569	positive regulation of macromolecule metabolic process
GO:0051052	0.541	regulation of DNA metabolic process
GO:0051173	0.485	positive regulation of nitrogen compound metabolic process
GO:0044260	0.420	cellular macromolecule metabolic process
GO:0032502	0.344	developmental process
GO:0048583	0.332	regulation of response to stimulus
GO:0071840	0.329	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.995	protein-containing complex
GO:1902494	0.989	catalytic complex
GO:0031981	0.971	nuclear lumen
GO:0005654	0.940	nucleoplasm
GO:0043228	0.915	non-membrane-bounded organelle
GO:0043232	0.912	intracellular non-membrane-bounded organelle
GO:0000502	0.860	proteasome complex
GO:0031597	0.826	cytosolic proteasome complex
GO:0005730	0.421	nucleolus
GO:0005694	0.348	chromosome
GO:0000785	0.339	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	0.999	ubiquitinyl hydrolase 1.

[back to server]