StarFunc result for job id Q9Y5K6

User Input

>input (639 residues)
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE
TEFKDDSLPIKRERHGNVASLVQRISTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYI
PQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDS
ETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKK
PEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLIS
KETGEAGWWRGELNGKEGVFPDNFAVQINELDKDFPKPKKPPPPAKAPAPKPELIAAEKK
YFSLKPEEKDEKSTLEQKPSKPAAPQVPPKKPTPPTKASNLLRSSGTVYPKRPEKPVPPP
PPIAKINGEVSSISSKFETEPVSKLKLDSEQLPLRPKSVDFDSLTVRTSKETDVVNFDDI
ASSENLLHLTANRPKMPGRRLPGRFNGGHSPTHSPEKILKLPKEEDSANLKPSELKKDTC
YSPKPSVYLSTPSSASKANTTAFLTPLEIKAKVETDDVKKNSLDELRAQIIELLCIVEAL
KKDHGKELEKLRKDLEEEKTMRSNLEMEIEKLKKAVLSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5K6	0.999	0.999	6.957E-88	639	1.000	1.000	Q9Y5K6.pdb.gz	CD2AP_HUMAN CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1
2	AFDB:F1LRS8	0.328	0.329	5.464E-76	637	0.851	0.854	F1LRS8.pdb.gz	CD2AP_RAT CD2-associated protein OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=1 SV=2
3	AFDB:F1R1N9	0.172	0.168	1.344E-46	657	0.491	0.478	F1R1N9.pdb.gz	F1R1N9_DANRE CD2-associated protein OS=Danio rerio OX=7955 GN=cd2apl PE=1 SV=1
4	AFDB:Q5JPT6	0.206	0.200	4.706E-38	665	0.396	0.380	Q5JPT6.pdb.gz	Q5JPT6_HUMAN GIG10 OS=Homo sapiens OX=9606 PE=1 SV=1
5	AFDB:Q5ZMQ7	0.192	0.171	8.165E-38	739	0.399	0.345	Q5ZMQ7.pdb.gz	Q5ZMQ7_CHICK SH3 domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_1g20 PE=1 SV=1
6	AFDB:E9QJP6	0.168	0.162	7.089E-36	669	0.401	0.383	E9QJP6.pdb.gz
7	AFDB:A0A0B4KI34	0.142	0.109	3.074E-23	941	0.227	0.154	A0A0B4KI34.pdb.gz	A0A0B4KI34_DROME CIN85 and CD2AP related, isoform J OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
8	AFDB:Q9VA36	0.133	0.105	3.626E-23	882	0.221	0.160	Q9VA36.pdb.gz	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
9	AFDB:Q5TCZ1	0.125	0.082	5.425E-17	1133	0.163	0.092	Q5TCZ1.pdb.gz	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
10	AFDB:Q6NRD3	0.147	0.118	5.425E-17	826	0.158	0.122	Q6NRD3.pdb.gz	SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis OX=8355 GN=sh3rf1 PE=1 SV=1
11	PDB:2lqnA	0.093	0.192	1.514E-8	303	0.067	0.142	2lqnA.pdb.gz
12	PDB:1griA	0.093	0.275	2.487E-8	211	0.074	0.223	1griA.pdb.gz
13	PDB:2eyzA	0.116	0.195	6.078E-7	304	0.058	0.122	2eyzA.pdb.gz
14	PDB:2dybA	0.090	0.191	1.080E-4	298	0.036	0.077	2dybA.pdb.gz
15	PDB:3ehqA	0.085	0.283	3.252E-4	182	0.030	0.104	3ehqA.pdb.gz
16	PDB:1k9aB	0.085	0.122	6.658E-4	441	0.019	0.027	1k9aB.pdb.gz
17	PDB:3qwyA	0.085	0.317	7.434E-4	170	0.031	0.118	3qwyA.pdb.gz
18	PDB:6x5hA	0.088	0.120	1.290E-3	467	0.023	0.032	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
19	PDB:4mt6A	0.077	0.125	1.363E-3	389	0.022	0.036	4mt6A.pdb.gz
20	PDB:1k0xA	0.086	0.463	1.897E-3	108	0.028	0.167	1k0xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LRS8	0.0	934	637	0.851	0.854	CD2AP_RAT CD2-associated protein OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=1 SV=2
2	Q80ZE7	0.0	924	637	0.842	0.845	Q80ZE7_RAT CD2AP/CMS OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=2 SV=1
3	Q9JLQ0	0.0	949	637	0.859	0.862	CD2AP_MOUSE CD2-associated protein OS=Mus musculus OX=10090 GN=Cd2ap PE=1 SV=3
4	Q9Y5K6	0.0	1283	639	1.000	1.000	CD2AP_HUMAN CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1
5	F1R1N9	3.46e-144	435	657	0.476	0.463	F1R1N9_DANRE CD2-associated protein OS=Danio rerio OX=7955 GN=cd2apl PE=1 SV=1
6	Q5ZMQ7	5.79e-100	323	739	0.396	0.342	Q5ZMQ7_CHICK SH3 domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_1g20 PE=1 SV=1
7	Q5JPT6	8.98e-99	318	665	0.401	0.385	Q5JPT6_HUMAN GIG10 OS=Homo sapiens OX=9606 PE=1 SV=1
8	Q96B97	8.98e-99	318	665	0.401	0.385	SH3K1_HUMAN SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3KBP1 PE=1 SV=2
9	Q925Q9	5.02e-95	309	709	0.393	0.354	SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Sh3kbp1 PE=1 SV=2
10	Q8R550	4.02e-94	307	709	0.388	0.350	SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Sh3kbp1 PE=1 SV=1
11	Q5PR31	4.01e-77	249	279	0.236	0.541	Q5PR31_DANRE CD2-associated protein like OS=Danio rerio OX=7955 GN=cd2apl PE=2 SV=1
12	A0A0B4KI34	4.94e-26	116	941	0.100	0.068	A0A0B4KI34_DROME CIN85 and CD2AP related, isoform J OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
13	Q9VA36	4.99e-26	116	882	0.100	0.073	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
14	Q7YU85	2.00e-25	114	880	0.100	0.073	Q7YU85_DROME SD08724p OS=Drosophila melanogaster OX=7227 GN=cindr PE=2 SV=1
15	M9PDC7	4.50e-20	97.4	1005	0.122	0.078	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
16	Q8INU2	5.20e-20	97.4	1014	0.122	0.077	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
17	A0A0B4KI32	7.85e-20	96.7	848	0.080	0.060	A0A0B4KI32_DROME CIN85 and CD2AP related, isoform E OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
18	O61639	3.35e-19	94.7	1011	0.125	0.079	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
19	Q91X43	6.73e-19	93.6	789	0.138	0.112	SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus OX=10090 GN=Sh3d19 PE=1 SV=2
20	Q15811	2.21e-18	92.4	1721	0.131	0.049	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16523 betaPIX_CC	7.3e+02	11.5	betaPIX coiled coil
2	PF00018 SH3_1	9.3e-38	138.9	SH3 domain
3	PF07653 SH3_2	2.3e-31	118.7	Variant SH3 domain
4	PF14604 SH3_9	1.5e-40	148.2	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352264

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264033	0.999	E3 ubiquitin-protein ligase CBL
2	9606.ENSP00000356587	0.999	Podocin
3	9606.ENSP00000368190	0.999	Nephrin
4	9606.ENSP00000358490	0.997	T-cell surface antigen CD2
5	9606.ENSP00000365745	0.990	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
6	9606.ENSP00000352138	0.983	Kin of IRRE-like protein 1
7	9606.ENSP00000265748	0.963	Anillin
8	9606.ENSP00000282397	0.949	Vascular endothelial growth factor receptor 1
9	9606.ENSP00000216487	0.943	Ras and Rab interactor 3
10	9606.ENSP00000352834	0.934	Unconventional myosin-Ic
11	9606.ENSP00000441543	0.929	Polyubiquitin-C
12	9606.ENSP00000428056	0.925	Phosphatidylinositol 3-kinase regulatory subunit alpha
13	9606.ENSP00000478570	0.922	Vascular endothelial growth factor A
14	9606.ENSP00000265944	0.914	Myosin-IIIa
15	9606.ENSP00000304283	0.906	Ras-related C3 botulinum toxin substrate 3
16	9606.ENSP00000393392	0.906	Unconventional myosin-Ia
17	9606.ENSP00000358994	0.903	Unconventional myosin-VI
18	9606.ENSP00000346671	0.901	Tyrosine-protein kinase Fyn
19	9606.ENSP00000253754	0.900	PDZ and LIM domain protein 4
20	9606.ENSP00000263967	0.900	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.915	cell adhesion molecule binding
GO:0045296	0.908	cadherin binding
GO:0042802	0.840	identical protein binding
GO:0019904	0.775	protein domain specific binding
GO:0017124	0.747	SH3 domain binding
GO:0005198	0.735	structural molecule activity
GO:0005200	0.686	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0065007	0.998	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0048522	0.950	positive regulation of cellular process
GO:0071840	0.942	cellular component organization or biogenesis
GO:0032879	0.941	regulation of localization
GO:0016043	0.921	cellular component organization
GO:0048519	0.824	negative regulation of biological process
GO:0006996	0.803	organelle organization
GO:0060341	0.752	regulation of cellular localization
GO:0048583	0.646	regulation of response to stimulus
GO:0048523	0.644	negative regulation of cellular process
GO:0019222	0.568	regulation of metabolic process
GO:0060255	0.551	regulation of macromolecule metabolic process
GO:0032880	0.542	regulation of protein localization
GO:0008152	0.529	metabolic process
GO:0071704	0.512	organic substance metabolic process
GO:0009966	0.464	regulation of signal transduction
GO:0051128	0.462	regulation of cellular component organization
GO:0044238	0.418	primary metabolic process
GO:0032501	0.393	multicellular organismal process
GO:0051049	0.379	regulation of transport
GO:0044237	0.366	cellular metabolic process
GO:0022607	0.344	cellular component assembly
GO:0006807	0.315	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0043229	0.999	intracellular organelle
GO:0032991	0.997	protein-containing complex
GO:0005829	0.996	cytosol
GO:0005886	0.995	plasma membrane
GO:0031982	0.994	vesicle
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0031974	0.985	membrane-enclosed lumen
GO:0005634	0.982	nucleus
GO:0043233	0.965	organelle lumen
GO:0070013	0.957	intracellular organelle lumen
GO:0042995	0.939	cell projection
GO:0005576	0.939	extracellular region
GO:0005856	0.929	cytoskeleton
GO:0120025	0.919	plasma membrane bounded cell projection
GO:0031410	0.917	cytoplasmic vesicle
GO:0065010	0.913	extracellular membrane-bounded organelle
GO:0031981	0.898	nuclear lumen
GO:1903561	0.888	extracellular vesicle
GO:0030054	0.880	cell junction
GO:0015629	0.854	actin cytoskeleton
GO:0005615	0.843	extracellular space
GO:0070062	0.778	extracellular exosome
GO:0031252	0.718	cell leading edge
GO:0005654	0.712	nucleoplasm
GO:0070161	0.589	anchoring junction
GO:0012505	0.521	endomembrane system
GO:0099513	0.447	polymeric cytoskeletal fiber
GO:0005884	0.433	actin filament
GO:0048471	0.429	perinuclear region of cytoplasm
GO:0015630	0.418	microtubule cytoskeleton
GO:0030139	0.409	endocytic vesicle
GO:0031941	0.382	filamentous actin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]