StarFunc result for job id Q9Y5N5

User Input

>input (214 residues)
MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVS
AFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLV
FNPPYVVTPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPE
EILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5N5	1.000	1.000	3.684E-47	214	1.000	1.000	Q9Y5N5.pdb.gz	N6MT1_HUMAN Methyltransferase N6AMT1 OS=Homo sapiens OX=9606 GN=N6AMT1 PE=1 SV=4
2	AFDB:Q6SKR2	0.991	0.991	4.266E-42	214	0.874	0.874	Q6SKR2.pdb.gz	N6MT1_MOUSE Methyltransferase N6AMT1 OS=Mus musculus OX=10090 GN=N6amt1 PE=1 SV=1
3	PDB:6kmsC	0.970	0.988	8.069E-41	210	0.981	1.000	6kmsC.pdb.gz	Structural insight into human N6amt1-Trm112 complex functioning as a protein methyltransferase.
4	AFDB:Q8VXU9	0.870	0.674	5.467E-24	278	0.402	0.309	Q8VXU9.pdb.gz	Q8VXU9_ARATH AT3g13440/MRP15_7 OS=Arabidopsis thaliana OX=3702 GN=NRF1 PE=1 SV=1
5	AFDB:Q9UT94	0.886	0.823	6.979E-24	231	0.388	0.359	Q9UT94.pdb.gz	MTQ2_SCHPO eRF1 methyltransferase catalytic subunit mtq2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtq2 PE=3 SV=1
6	AFDB:Q03920	0.866	0.841	7.348E-21	221	0.355	0.344	Q03920.pdb.gz	MTQ2_YEAST eRF1 methyltransferase catalytic subunit MTQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTQ2 PE=1 SV=1
7	AFDB:B0B9D1	0.733	0.551	3.229E-12	290	0.220	0.162	B0B9D1.pdb.gz	PRMC_CHLT2 Release factor glutamine methyltransferase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) OX=471472 GN=prmC PE=1 SV=1
8	AFDB:Q9Y5R4	0.721	0.476	8.576E-12	338	0.248	0.157	Q9Y5R4.pdb.gz	HEMK1_HUMAN MTRF1L release factor glutamine methyltransferase OS=Homo sapiens OX=9606 GN=HEMK1 PE=1 SV=1
9	AFDB:Q921L7	0.735	0.480	1.579E-11	340	0.248	0.156	Q921L7.pdb.gz	HEMK1_MOUSE MTRF1L release factor glutamine methyltransferase OS=Mus musculus OX=10090 GN=Hemk1 PE=2 SV=2
10	AFDB:Q9FMI5	0.697	0.412	5.446E-10	377	0.220	0.125	Q9FMI5.pdb.gz	Q9FMI5_ARATH At5g64156 OS=Arabidopsis thaliana OX=3702 GN=MHJ24.13 PE=1 SV=1
11	PDB:3cjtA	0.605	0.517	1.012E-9	254	0.192	0.161	3cjtA.pdb.gz	Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
12	AFDB:P39199	0.642	0.458	1.446E-9	310	0.187	0.129	P39199.pdb.gz	PRMB_ECOLI Ribosomal protein uL3 glutamine methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=prmB PE=1 SV=3
13	PDB:3a25A	0.518	0.432	2.421E-8	264	0.136	0.110	3a25A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
14	PDB:1sqfA	0.580	0.317	2.574E-8	425	0.136	0.068	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
15	PDB:3a27A	0.488	0.480	2.736E-8	219	0.136	0.132	3a27A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
16	PDB:6jclG	0.592	0.580	6.835E-8	219	0.136	0.132	6jclG.pdb.gz	Structural and biochemical characterization of Rv0187, an O-methyltransferase from Mycobacterium tuberculosis.
17	PDB:6h2vA	0.591	0.602	9.858E-8	210	0.145	0.148	6h2vA.pdb.gz	The human 18S rRNA m6A methyltransferase METTL5 is stabilized by TRMT112.
18	PDB:1qzzA	0.501	0.334	1.184E-7	340	0.154	0.097	1qzzA.pdb.gz	Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
19	PDB:5x7fA	0.550	0.590	1.815E-7	198	0.145	0.157	5x7fA.pdb.gz	Structure of a O-methyltransferase from Mycobacterium tuberculosis at 2.0 resolution
20	PDB:2b3tA	0.707	0.560	2.051E-7	276	0.187	0.145	2b3tA.pdb.gz	Molecular basis for bacterial class I release factor methylation by PrmC

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y5N5	1.07e-158	439	214	1.000	1.000	N6MT1_HUMAN Methyltransferase N6AMT1 OS=Homo sapiens OX=9606 GN=N6AMT1 PE=1 SV=4
2	Q6SKR2	4.63e-128	361	214	0.874	0.874	N6MT1_MOUSE Methyltransferase N6AMT1 OS=Mus musculus OX=10090 GN=N6amt1 PE=1 SV=1
3	Q8VXU9	3.86e-46	155	278	0.402	0.309	Q8VXU9_ARATH AT3g13440/MRP15_7 OS=Arabidopsis thaliana OX=3702 GN=NRF1 PE=1 SV=1
4	Q9UT94	3.66e-36	128	231	0.383	0.355	MTQ2_SCHPO eRF1 methyltransferase catalytic subunit mtq2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtq2 PE=3 SV=1
5	Q03920	7.74e-31	114	221	0.346	0.335	MTQ2_YEAST eRF1 methyltransferase catalytic subunit MTQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTQ2 PE=1 SV=1
6	Q9Y5R4	3.03e-06	49.3	338	0.206	0.130	HEMK1_HUMAN MTRF1L release factor glutamine methyltransferase OS=Homo sapiens OX=9606 GN=HEMK1 PE=1 SV=1
7	Q9FMI5	1.45e-05	47.4	377	0.248	0.141	Q9FMI5_ARATH At5g64156 OS=Arabidopsis thaliana OX=3702 GN=MHJ24.13 PE=1 SV=1
8	Q921L7	3.54e-05	45.8	340	0.192	0.121	HEMK1_MOUSE MTRF1L release factor glutamine methyltransferase OS=Mus musculus OX=10090 GN=Hemk1 PE=2 SV=2
9	B0B9D1	4.18e-05	45.4	290	0.192	0.141	PRMC_CHLT2 Release factor glutamine methyltransferase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) OX=471472 GN=prmC PE=1 SV=1
10	P31825	1.59e-04	43.5	245	0.126	0.110	TRMN6_ECOLI tRNA1(Val) (adenine(37)-N6)-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=yfiC PE=1 SV=2
11	P39199	0.032	37.0	310	0.210	0.145	PRMB_ECOLI Ribosomal protein uL3 glutamine methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=prmB PE=1 SV=3
12	Q9R144	0.27	34.3	448	0.107	0.051	ANM2_MOUSE Protein arginine N-methyltransferase 2 OS=Mus musculus OX=10090 GN=Prmt2 PE=1 SV=1
13	B3DIQ7	0.53	33.5	357	0.103	0.062	B3DIQ7_DANRE Methyltransferase 22, Kin17 lysine OS=Danio rerio OX=7955 GN=mettl22 PE=2 SV=1
14	P9WJZ7	0.72	32.7	224	0.182	0.174	Y1220_MYCTU Probable O-methyltransferase Rv1220c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1220c PE=1 SV=2
15	O74340	0.76	33.1	436	0.107	0.053	DCA13_SCHPO Protein sof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sof1 PE=3 SV=1
16	A0A0S2Z3N3	1.6	32.0	433	0.103	0.051	A0A0S2Z3N3_HUMAN Protein arginine methyltransferase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=PRMT2 PE=2 SV=1
17	P55345	1.6	32.0	433	0.103	0.051	ANM2_HUMAN Protein arginine N-methyltransferase 2 OS=Homo sapiens OX=9606 GN=PRMT2 PE=1 SV=1
18	Q88RA3	1.6	32.0	277	0.206	0.159	TAUD_PSEPK Alpha-ketoglutarate-dependent taurine dioxygenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=tauD PE=1 SV=1
19	P22734	1.8	31.6	264	0.098	0.080	COMT_RAT Catechol O-methyltransferase OS=Rattus norvegicus OX=10116 GN=Comt PE=1 SV=2
20	O88587	2.2	31.2	265	0.093	0.075	COMT_MOUSE Catechol O-methyltransferase OS=Mus musculus OX=10090 GN=Comt PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17494 DUF5429	1.2e+02	14.1	Family of unknown function (DUF5429)
2	PF06080 DUF938	2.1e+02	13.1	Protein of unknown function (DUF938)
3	PF08241 Methyltransf_11	60	15.7	Methyltransferase domain
4	PF08242 Methyltransf_12	21	17.3	Methyltransferase domain
5	PF10294 Methyltransf_16	80	14.4	Lysine methyltransferase
6	PF13578 Methyltransf_24	27	17.2	Methyltransferase domain
7	PF13649 Methyltransf_25	0.1	24.6	Methyltransferase domain
8	PF13847 Methyltransf_31	0.61	21.3	Methyltransferase domain
9	PF10017 Methyltransf_33	1.3e+02	13.2	Histidine-specific methyltransferase, SAM-dependent
10	PF05175 MTS	4e-06	38.1	Methyltransferase small domain
11	PF01135 PCMT	13	17.0	Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
12	PF06325 PrmA	0.28	22.2	Ribosomal protein L11 methyltransferase (PrmA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303584

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438349	0.999	Multifunctional methyltransferase subunit TRM112-like protein
2	9606.ENSP00000353741	0.982	Eukaryotic peptide chain release factor subunit 1
3	9606.ENSP00000314441	0.946	tRNA (guanine-N(7)-)-methyltransferase
4	9606.ENSP00000333934	0.942	tRNA (guanine(10)-N2)-methyltransferase homolog
5	9606.ENSP00000398131	0.934	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
6	9606.ENSP00000374399	0.933	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
7	9606.ENSP00000341247	0.924	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
8	9606.ENSP00000401191	0.919	Probable 18S rRNA (guanine-N(7))-methyltransferase
9	9606.ENSP00000466967	0.915	tRNA (guanine(26)-N(2))-dimethyltransferase
10	9606.ENSP00000397673	0.909	Alkylated DNA repair protein alkB homolog 8
11	9606.ENSP00000404843	0.870	HemK methyltransferase family member 1
12	9606.ENSP00000458290	0.834	N(6)-adenine-specific DNA methyltransferase that mediates methylation of DNA on the 6th position of adenine (N(6)- methyladenosine) and is required to regulate Polycomb silencing. N(6)- methyladenosine deposition by METTL4 triggers ubiquitination and degradation of sensor proteins ASXL1 and MPND, leading to inactivation of the PR-DUB complex and subsequent preservation of Polycomb silencing
13	9606.ENSP00000244537	0.829	Histone cluster 1 H4 family member f
14	9606.ENSP00000347168	0.829	Histone cluster 1 H4 family member j
15	9606.ENSP00000366956	0.829	Histone cluster 1 H4 family member h
16	9606.ENSP00000366974	0.829	Histone cluster 1 H4 family member b
17	9606.ENSP00000367034	0.829	Histone cluster 1 H4 family member c
18	9606.ENSP00000443017	0.829	Histone cluster 4, H4
19	9606.ENSP00000462355	0.829	Histone cluster 2 H4 family member b
20	9606.ENSP00000462667	0.829	Histone cluster 2 H4 family member a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008757	1.000	S-adenosylmethionine-dependent methyltransferase activity
GO:0008170	1.000	N-methyltransferase activity
GO:0008276	1.000	protein methyltransferase activity
GO:0036009	0.984	protein-glutamine N-methyltransferase activity
GO:0140640	0.847	catalytic activity, acting on a nucleic acid
GO:0043169	0.839	cation binding
GO:0140097	0.836	catalytic activity, acting on DNA
GO:1904047	0.794	S-adenosyl-L-methionine binding
GO:0042054	0.671	histone methyltransferase activity
GO:0009008	0.628	DNA-methyltransferase activity
GO:0018024	0.491	histone lysine N-methyltransferase activity
GO:0009007	0.432	site-specific DNA-methyltransferase (adenine-specific) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043414	0.996	macromolecule methylation
GO:0008213	0.996	protein alkylation
GO:0006479	0.993	protein methylation
GO:0034641	0.637	cellular nitrogen compound metabolic process
GO:1901360	0.615	organic cyclic compound metabolic process
GO:0065007	0.608	biological regulation
GO:0006725	0.603	cellular aromatic compound metabolic process
GO:0050789	0.563	regulation of biological process
GO:0046483	0.561	heterocycle metabolic process
GO:0006139	0.533	nucleobase-containing compound metabolic process
GO:0050794	0.501	regulation of cellular process
GO:0090304	0.478	nucleic acid metabolic process
GO:0050896	0.310	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0005737	0.989	cytoplasm
GO:0032991	0.975	protein-containing complex
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0005829	0.950	cytosol
GO:0005634	0.944	nucleus
GO:0070013	0.438	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
RHEA:51736	0.491	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine
RHEA:15197	0.432	a 2'-deoxyadenosine in DNA + S-adenosyl-L-methionine = an N(6)-methyl-2'-deoxyadenosine in DNA + H(+) + S-adenosyl-L-homocysteine
EC:2.1.1.72	0.432	site-specific DNA-methyltransferase (adenine-specific).

[back to server]