StarFunc result for job id Q9Y5P8

User Input

>input (575 residues)
MPPGKVLQPVLKMKVDELFLYWLSEASTQRMLQDCLRRIKAPGRDQPTPGDGEQPGAWPT
APLAAPRPSGLEPPGTPGPGPALPLGAASSPRNAPHVRGTRRSAGTRVVQTRKEEPLPPA
TSQSIPTFYFPRGRPQDSVNVDAVISKIESTFARFPHERATMDDMGLVAKACGCPLYWKG
PLFYGAGGERTGSVSVHKFVAMWRKILQNCHDDAAKFVHLLMSPGCNYLVQEDFVPFLQD
VVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGRITCAELRRSSFLQNVALLEE
EADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTKMIDRIFSGAV
TRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQ
CRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDH
EQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSA
LRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5P8	1.000	1.000	7.536E-80	575	1.000	1.000	Q9Y5P8.pdb.gz	P2R3B_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta OS=Homo sapiens OX=9606 GN=PPP2R3B PE=1 SV=2
2	AFDB:E9QG28	0.698	0.339	5.255E-49	1192	0.544	0.263	E9QG28.pdb.gz	E9QG28_DANRE Protein phosphatase 2, regulatory subunit B'', alpha OS=Danio rerio OX=7955 GN=ppp2r3a PE=4 SV=2
3	AFDB:Q06190	0.692	0.349	1.303E-46	1150	0.511	0.256	Q06190.pdb.gz	P2R3A_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens OX=9606 GN=PPP2R3A PE=1 SV=1
4	AFDB:Q9Z176	0.681	0.796	3.566E-46	491	0.490	0.574	Q9Z176.pdb.gz	P2R3D_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit delta OS=Mus musculus OX=10090 GN=Ppp2r3d PE=2 SV=1
5	AFDB:Q9XGR4	0.643	0.685	9.567E-34	538	0.339	0.362	Q9XGR4.pdb.gz	2AB2A_ARATH Serine/threonine protein phosphatase 2A regulatory subunit B''alpha OS=Arabidopsis thaliana OX=3702 GN=B''ALPHA PE=1 SV=1
6	AFDB:Q8VZQ4	0.627	0.669	5.130E-32	536	0.336	0.360	Q8VZQ4.pdb.gz	2AB2C_ARATH Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma OS=Arabidopsis thaliana OX=3702 GN=B''GAMMA PE=1 SV=1
7	AFDB:Q17744	0.657	0.678	6.670E-32	557	0.325	0.336	Q17744.pdb.gz	Q17744_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F43B10.1 PE=1 SV=4
8	AFDB:Q38DH1	0.562	0.478	4.866E-22	681	0.270	0.228	Q38DH1.pdb.gz	Q38DH1_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3350 PE=4 SV=1
9	AFDB:Q969Q6	0.437	0.548	3.095E-15	453	0.136	0.172	Q969Q6.pdb.gz	P2R3C_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Homo sapiens OX=9606 GN=PPP2R3C PE=1 SV=1
10	AFDB:Q9FEE2	0.445	0.524	7.425E-15	480	0.141	0.169	Q9FEE2.pdb.gz	TON2_ARATH Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 OS=Arabidopsis thaliana OX=3702 GN=TON2 PE=1 SV=1
11	PDB:2ct9B	0.214	0.511	1.884E-4	198	0.073	0.212	2ct9B.pdb.gz	Structural characterization of calcineurin B homologous protein 1
12	PDB:2zfdA	0.225	0.600	7.313E-4	183	0.050	0.158	2zfdA.pdb.gz	The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
13	PDB:1v1fA	0.219	0.559	9.935E-4	188	0.056	0.170	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
14	PDB:2ggmA	0.120	0.365	1.680E-3	149	0.059	0.228	2ggmA.pdb.gz	The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
15	PDB:5x9aB	0.225	0.567	1.680E-3	198	0.061	0.177	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition
16	PDB:6tz8B	0.206	0.542	1.755E-3	174	0.059	0.195	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
17	PDB:5d43A	0.119	0.370	2.001E-3	150	0.064	0.247	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
18	PDB:7rroI4	0.216	0.556	2.602E-3	187	0.061	0.187	7rroI4.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:1a2xA	0.115	0.361	3.383E-3	158	0.052	0.190	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
20	PDB:2lhiA	0.120	0.302	3.534E-3	176	0.063	0.205	2lhiA.pdb.gz	Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A803JG39	0.0	605	1129	0.497	0.253	A0A803JG39_XENTR Protein phosphatase 2 regulatory subunit B''alpha OS=Xenopus tropicalis OX=8364 GN=ppp2r3a PE=4 SV=1
2	B0S5Q0	0.0	617	520	0.496	0.548	B0S5Q0_DANRE Protein phosphatase 2, regulatory subunit B'', alpha OS=Danio rerio OX=7955 GN=ppp2r3a PE=4 SV=1
3	E9QG28	0.0	627	1192	0.496	0.239	E9QG28_DANRE Protein phosphatase 2, regulatory subunit B'', alpha OS=Danio rerio OX=7955 GN=ppp2r3a PE=4 SV=2
4	Q06190	0.0	611	1150	0.468	0.234	P2R3A_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens OX=9606 GN=PPP2R3A PE=1 SV=1
5	Q9Y5P8	0.0	1192	575	1.000	1.000	P2R3B_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta OS=Homo sapiens OX=9606 GN=PPP2R3B PE=1 SV=2
6	Q9Z176	0.0	565	491	0.503	0.589	P2R3D_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit delta OS=Mus musculus OX=10090 GN=Ppp2r3d PE=2 SV=1
7	Q9XGR4	7.77e-113	348	538	0.332	0.355	2AB2A_ARATH Serine/threonine protein phosphatase 2A regulatory subunit B''alpha OS=Arabidopsis thaliana OX=3702 GN=B''ALPHA PE=1 SV=1
8	Q8VZQ4	5.25e-109	338	536	0.327	0.351	2AB2C_ARATH Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma OS=Arabidopsis thaliana OX=3702 GN=B''GAMMA PE=1 SV=1
9	Q17744	8.75e-109	338	557	0.283	0.293	Q17744_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F43B10.1 PE=1 SV=4
10	Q38DH1	5.42e-55	199	681	0.216	0.182	Q38DH1_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3350 PE=4 SV=1
11	Q9JK24	1.37e-26	115	453	0.120	0.152	P2R3C_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Mus musculus OX=10090 GN=Ppp2r3c PE=1 SV=2
12	Q969Q6	3.58e-26	114	453	0.120	0.152	P2R3C_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Homo sapiens OX=9606 GN=PPP2R3C PE=1 SV=1
13	Q9FEE2	4.26e-17	86.7	480	0.111	0.133	TON2_ARATH Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 OS=Arabidopsis thaliana OX=3702 GN=TON2 PE=1 SV=1
14	Q580J5	1.01e-04	47.4	492	0.096	0.112	Q580J5_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.810 PE=4 SV=1
15	O02217	0.096	37.7	404	0.077	0.109	P2R31_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit rsa-1 OS=Caenorhabditis elegans OX=6239 GN=rsa-1 PE=1 SV=2
16	A0A0B4LFI7	0.14	37.7	1282	0.040	0.018	A0A0B4LFI7_DROME NADPH oxidase, isoform B OS=Drosophila melanogaster OX=7227 GN=Nox PE=4 SV=1
17	A8DWJ8	0.14	37.7	1340	0.040	0.017	A8DWJ8_DROME NADPH oxidase, isoform C OS=Drosophila melanogaster OX=7227 GN=Nox PE=4 SV=1
18	Q75K28	0.15	36.2	186	0.043	0.134	NCSA_DICDI Calcium-binding protein NCSA OS=Dictyostelium discoideum OX=44689 GN=ncsA PE=1 SV=2
19	Q9FDX6	0.44	34.7	160	0.050	0.181	CP1_ARATH Calcium-binding protein CP1 OS=Arabidopsis thaliana OX=3702 GN=CP1 PE=2 SV=1
20	Q7XSQ5	1.1	34.7	533	0.073	0.079	CDPKC_ORYSJ Calcium-dependent protein kinase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=CPK12 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.12	23.0	EF hand
2	PF17958 EF-hand_13	1.9e-38	141.5	EF-hand domain
3	PF13202 EF-hand_5	0.019	25.6	EF hand
4	PF13405 EF-hand_6	0.33	21.9	EF-hand domain
5	PF13499 EF-hand_7	7.6e-19	79.3	EF-hand domain pair
6	PF13833 EF-hand_8	0.058	24.5	EF-hand domain pair

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375080

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324804	0.999	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
2	9606.ENSP00000418447	0.999	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
3	9606.ENSP00000325074	0.972	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
4	9606.ENSP00000221138	0.964	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
5	9606.ENSP00000377036	0.959	Serine/threonine-protein phosphatase 2A activator
6	9606.ENSP00000382021	0.955	Leucine carboxyl methyltransferase 1
7	9606.ENSP00000362768	0.947	Retinoblastoma-like protein 1
8	9606.ENSP00000381461	0.940	Protein phosphatase methylesterase 1
9	9606.ENSP00000311344	0.923	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
10	9606.ENSP00000399970	0.907	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
11	9606.ENSP00000261461	0.905	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
12	9606.ENSP00000412324	0.905	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
13	9606.ENSP00000262133	0.903	Retinoblastoma-like protein 2
14	9606.ENSP00000267163	0.903	Retinoblastoma-associated protein
15	9606.ENSP00000209728	0.891	Cell division control protein 6 homolog
16	9606.ENSP00000164133	0.857	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
17	9606.ENSP00000335083	0.856	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
18	9606.ENSP00000341779	0.848	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
19	9606.ENSP00000377936	0.830	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
20	9606.ENSP00000417963	0.828	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019888	1.000	protein phosphatase regulator activity
GO:0003824	0.332	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.890	cellular process
GO:0051726	0.813	regulation of cell cycle
GO:0071704	0.369	organic substance metabolic process
GO:0044238	0.328	primary metabolic process
GO:0006807	0.325	nitrogen compound metabolic process
GO:1901564	0.311	organonitrogen compound metabolic process
GO:0043170	0.308	macromolecule metabolic process
GO:0048519	0.306	negative regulation of biological process
GO:0019538	0.301	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0031981	0.996	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005829	0.979	cytosol
GO:0032991	0.821	protein-containing complex
GO:0016020	0.637	membrane
GO:0008287	0.481	protein serine/threonine phosphatase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]