StarFunc result for job id Q9Y5Q3

User Input

>input (323 residues)
MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPL
STPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQP
LQSFDSFRGAHHHHHHHHPHPHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPA
QQLPTSHPGPGPHATASATAAGGNGSVEDRFSDDQLVSMSVRELNRHLRGFTKDEVIRLK
QKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEK
LANSGFREAGSTSDSPSSPEFFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54841	0.637	0.637	4.708E-46	323	0.972	0.972	P54841.pdb.gz	MAFB_MOUSE Transcription factor MafB OS=Mus musculus OX=10090 GN=Mafb PE=1 SV=1
2	AFDB:Q98UK5	0.364	0.333	1.028E-30	356	0.715	0.649	Q98UK5.pdb.gz	MAFB_DANRE Transcription factor MafB OS=Danio rerio OX=7955 GN=mafb PE=2 SV=1
3	AFDB:D3ZNT6	0.440	0.399	6.267E-21	361	0.591	0.529	D3ZNT6.pdb.gz	MAFA_RAT Transcription factor MafA OS=Rattus norvegicus OX=10116 GN=Mafa PE=1 SV=1
4	AFDB:B3DGW9	0.367	0.372	3.395E-19	318	0.474	0.481	B3DGW9.pdb.gz
5	AFDB:Q9Y4A8	0.315	0.151	5.283E-4	694	0.226	0.105	Q9Y4A8.pdb.gz	NF2L3_HUMAN Nuclear factor erythroid 2-related factor 3 OS=Homo sapiens OX=9606 GN=NFE2L3 PE=1 SV=1
6	AFDB:O14867	0.282	0.134	3.068E-3	736	0.180	0.079	O14867.pdb.gz	BACH1_HUMAN Transcription regulator protein BACH1 OS=Homo sapiens OX=9606 GN=BACH1 PE=1 SV=2
7	AFDB:P38261	0.194	0.095	1.270E-2	753	0.152	0.065	P38261.pdb.gz	EXO84_YEAST Exocyst complex component EXO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EXO84 PE=1 SV=1
8	AFDB:A0A0R4IAV4	0.232	0.241	1.782E-2	310	0.195	0.203	A0A0R4IAV4.pdb.gz
9	AFDB:A8E7N0	0.229	0.228	2.183E-2	325	0.186	0.185	A8E7N0.pdb.gz
10	AFDB:A7RIQ6	0.199	0.188	4.013E-2	343	0.183	0.172	A7RIQ6.pdb.gz	A7RIQ6_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g238589 PE=1 SV=1
11	PDB:6yxxBS	0.154	0.288	4.674	161	0.053	0.106	6yxxBS.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
12	PDB:2r6eA	0.076	0.065	5.352	387	0.025	0.021	2r6eA.pdb.gz
13	PDB:2q0oD	0.077	0.279	6.127	87	0.025	0.092	2q0oD.pdb.gz	Structural basis for antiactivation in bacterial quorum sensing.
14	PDB:1fpoA	0.071	0.118	7.506	171	0.022	0.041	1fpoA.pdb.gz
15	PDB:1i7fA	0.065	0.088	8.594	228	0.028	0.039	1i7fA.pdb.gz
16	PDB:7oxoA	0.129	0.058	8.594	776	0.034	0.014	7oxoA.pdb.gz	Catalytic cycling of human mitochondrial Lon protease.
17	PDB:5svaU	0.128	0.221	9.839	156	0.050	0.103	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54841	0.0	644	323	0.972	0.972	MAFB_MOUSE Transcription factor MafB OS=Mus musculus OX=10090 GN=Mafb PE=1 SV=1
2	P54842	0.0	650	323	0.978	0.978	MAFB_RAT Transcription factor MafB OS=Rattus norvegicus OX=10116 GN=Mafb PE=1 SV=1
3	Q9Y5Q3	0.0	662	323	1.000	1.000	MAFB_HUMAN Transcription factor MafB OS=Homo sapiens OX=9606 GN=MAFB PE=1 SV=2
4	A3KMR8	3.76e-78	243	315	0.542	0.556	MAFA_DANRE Transcription factor MafAa OS=Danio rerio OX=7955 GN=mafaa PE=2 SV=1
5	Q98UK5	7.89e-69	220	356	0.325	0.295	MAFB_DANRE Transcription factor MafB OS=Danio rerio OX=7955 GN=mafb PE=2 SV=1
6	P54845	2.00e-61	197	237	0.399	0.544	NRL_HUMAN Neural retina-specific leucine zipper protein OS=Homo sapiens OX=9606 GN=NRL PE=1 SV=1
7	Q6P5N3	1.56e-56	187	318	0.495	0.503	Q6P5N3_DANRE Krml2.2 protein OS=Danio rerio OX=7955 GN=krml2.2 PE=2 SV=1
8	Q8CF90	7.93e-45	158	359	0.238	0.214	MAFA_MOUSE Transcription factor MafA OS=Mus musculus OX=10090 GN=Mafa PE=1 SV=1
9	Q8NHW3	1.15e-44	157	353	0.238	0.218	MAFA_HUMAN Transcription factor MafA OS=Homo sapiens OX=9606 GN=MAFA PE=1 SV=2
10	D3ZNT6	1.23e-44	157	361	0.238	0.213	MAFA_RAT Transcription factor MafA OS=Rattus norvegicus OX=10116 GN=Mafa PE=1 SV=1
11	P54846	4.41e-38	137	237	0.211	0.287	NRL_MOUSE Neural retina-specific leucine zipper protein OS=Mus musculus OX=10090 GN=Nrl PE=1 SV=1
12	O60675	2.31e-33	122	156	0.204	0.423	MAFK_HUMAN Transcription factor MafK OS=Homo sapiens OX=9606 GN=MAFK PE=1 SV=1
13	Q61827	2.39e-33	122	156	0.204	0.423	MAFK_MOUSE Transcription factor MafK OS=Mus musculus OX=10090 GN=Mafk PE=1 SV=1
14	Q6IRI7	6.08e-33	121	156	0.201	0.417	Q6IRI7_RAT V-maf musculoaponeurotic fibrosarcoma oncogene homolog K (Avian) OS=Rattus norvegicus OX=10116 GN=Mafk PE=1 SV=1
15	Q6I6N2	1.57e-31	117	162	0.180	0.358	Q6I6N2_DANRE Transcription factor MafG OS=Danio rerio OX=7955 GN=mafg1 PE=2 SV=1
16	O54790	1.98e-31	117	162	0.201	0.401	MAFG_MOUSE Transcription factor MafG OS=Mus musculus OX=10090 GN=Mafg PE=1 SV=1
17	Q4V999	9.33e-31	115	154	0.170	0.357	Q4V999_DANRE Transcription factor MafK OS=Danio rerio OX=7955 GN=mafk PE=2 SV=1
18	A0A0R4IVU1	9.84e-31	115	157	0.170	0.350	A0A0R4IVU1_DANRE Transcription factor MafK isoform X1 OS=Danio rerio OX=7955 GN=mafk PE=4 SV=1
19	Q76MX4	1.17e-30	116	189	0.192	0.328	MAFG_RAT Transcription factor MafG OS=Rattus norvegicus OX=10116 GN=Mafg PE=2 SV=2
20	Q6NW89	1.84e-30	115	171	0.176	0.333	Q6NW89_DANRE Transcription factor mafG2 OS=Danio rerio OX=7955 GN=mafg2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	5.7	18.4	bZIP transcription factor
2	PF07716 bZIP_2	37	15.8	Basic region leucine zipper
3	PF03131 bZIP_Maf	6.4e-31	118.1	bZIP Maf transcription factor
4	PF09789 CC149	1.4e+02	13.2	Coiled-coil domain-containing protein 149-A
5	PF06698 DUF1192	53	15.3	Protein of unknown function (DUF1192)
6	PF13747 DUF4164	37	16.0	Domain of unknown function (DUF4164)
7	PF05622 HOOK	17	15.6	HOOK protein coiled-coil region
8	PF16471 JIP_LZII	6.6e+02	11.9	JNK-interacting protein leucine zipper II
9	PF14662 KASH_CCD	4.1	18.8	Coiled-coil region of CCDC155 or KASH
10	PF08383 Maf_N	1.4e-17	74.4	Maf N-terminal region
11	PF04899 MbeD_MobD	2.2e+02	13.4	MbeD/MobD like
12	PF15136 UPF0449	1e+02	14.8	Uncharacterised protein family UPF0449
13	PF04871 Uso1_p115_C	1.2e+02	14.4	Uso1 / p115 like vesicle tethering protein, C terminal region
14	PF04652 Vta1	94	14.4	Vta1 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007859

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000019981	0.867	Fos proto-oncogene, AP-1 transcription factor subunit
2	61853.ENSNLEP00000017965	0.820	Jun proto-oncogene, AP-1 transcription factor subunit
3	61853.ENSNLEP00000022685	0.755	annotation not available
4	61853.ENSNLEP00000002936	0.746	Nuclear factor, erythroid 2-like 1
5	61853.ENSNLEP00000004088	0.689	BTB and CNC homology 1, basic leucine zipper transcription factor 1
6	61853.ENSNLEP00000007294	0.689	Nuclear factor, erythroid 2-like 2
7	61853.ENSNLEP00000014670	0.689	Early growth response 2
8	61853.ENSNLEP00000021427	0.689	Nuclear factor, erythroid 2
9	61853.ENSNLEP00000016142	0.667	BTB and CNC homology 1, basic leucine zipper transcription factor 2
10	61853.ENSNLEP00000008542	0.652	Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
11	61853.ENSNLEP00000009098	0.622	ETS proto-oncogene 1, transcription factor
12	61853.ENSNLEP00000010154	0.590	Uncharacterized protein
13	61853.ENSNLEP00000012925	0.590	Interferon regulatory factor 4
14	61853.ENSNLEP00000018142	0.572	Nuclear factor, erythroid 2-like 3
15	61853.ENSNLEP00000015527	0.569	Interleukin 4
16	61853.ENSNLEP00000017707	0.566	Spi-1 proto-oncogene
17	61853.ENSNLEP00000019998	0.561	Jun dimerization protein 2
18	61853.ENSNLEP00000015519	0.536	Interleukin 13
19	61853.ENSNLEP00000006197	0.534	Uncharacterized protein
20	61853.ENSNLEP00000006421	0.527	Solute carrier family 2 (facilitated glucose transporter), member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0042802	0.994	identical protein binding
GO:0000978	0.985	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.966	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0051171	0.993	regulation of nitrogen compound metabolic process
GO:0048518	0.990	positive regulation of biological process
GO:0080090	0.990	regulation of primary metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0010468	0.988	regulation of gene expression
GO:0010556	0.987	regulation of macromolecule biosynthetic process
GO:0009893	0.977	positive regulation of metabolic process
GO:0006355	0.977	regulation of DNA-templated transcription
GO:0048522	0.934	positive regulation of cellular process
GO:0010557	0.909	positive regulation of macromolecule biosynthetic process
GO:0045935	0.909	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.902	regulation of transcription by RNA polymerase II
GO:0051254	0.889	positive regulation of RNA metabolic process
GO:0031328	0.887	positive regulation of cellular biosynthetic process
GO:0045893	0.881	positive regulation of DNA-templated transcription
GO:0045944	0.844	positive regulation of transcription by RNA polymerase II
GO:0048523	0.824	negative regulation of cellular process
GO:0032502	0.760	developmental process
GO:0048856	0.747	anatomical structure development
GO:0009987	0.709	cellular process
GO:0071704	0.368	organic substance metabolic process
GO:0032501	0.339	multicellular organismal process
GO:0002682	0.320	regulation of immune system process
GO:0048513	0.301	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.979	intracellular organelle lumen
GO:0032991	0.976	protein-containing complex
GO:0005654	0.972	nucleoplasm
GO:0005667	0.697	transcription regulator complex
GO:0140513	0.410	nuclear protein-containing complex
GO:0005737	0.325	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]