StarFunc result for job id Q9Y5Q5

User Input

>input (1042 residues)
MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVL
LLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVSTAHPDQHVPA
WTTDASLPGDQSHRNTSACMNITHSQCQMLPYHATLTPLLSVVRNMEMEKFLKFFTYLHR
LSCYQHIMLFGCTLAFPECIIDGDDSHGLLPCRSFCEAAKEGCESVLGMVNYSWPDFLRC
SQFRNQTESSNVSRICFSPQQENGKQLLCGRGENFLCASGICIPGKLQCNGYNDCDDWSD
EAHCNCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCNPTTEHRCGDGRCIAMEW
VCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTS
CQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHR
TQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERC
ESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCD
GQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDEL
ECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQE
ILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSK
ISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLT
VAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSE
DISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFD
MKTITTRMICAGYESGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVY
SNVSYFVEWIKRQIYIQTFLLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KR90	0.574	0.591	0.000	1005	0.963	0.998	J3KR90.pdb.gz	J3KR90_HUMAN Corin, serine peptidase OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=1
2	AFDB:Q9Y5Q5	1.000	1.000	0.000	1042	1.000	1.000	Q9Y5Q5.pdb.gz	CORIN_HUMAN Atrial natriuretic peptide-converting enzyme OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=2
3	AFDB:Q9Z319	0.784	0.737	0.000	1113	0.823	0.771	Q9Z319.pdb.gz	CORIN_MOUSE Atrial natriuretic peptide-converting enzyme OS=Mus musculus OX=10090 GN=Corin PE=2 SV=2
4	AFDB:P98072	0.310	0.311	1.846E-40	1035	0.125	0.126	P98072.pdb.gz	ENTK_BOVIN Enteropeptidase OS=Bos taurus OX=9913 GN=TMPRSS15 PE=1 SV=1
5	AFDB:P98073	0.312	0.318	2.553E-40	1019	0.130	0.132	P98073.pdb.gz	ENTK_HUMAN Enteropeptidase OS=Homo sapiens OX=9606 GN=TMPRSS15 PE=1 SV=3
6	AFDB:P57727	0.288	0.604	3.024E-35	454	0.116	0.267	P57727.pdb.gz	TMPS3_HUMAN Transmembrane protease serine 3 OS=Homo sapiens OX=9606 GN=TMPRSS3 PE=1 SV=2
7	AFDB:O15393	0.285	0.559	3.557E-35	492	0.128	0.270	O15393.pdb.gz	TMPS2_HUMAN Transmembrane protease serine 2 OS=Homo sapiens OX=9606 GN=TMPRSS2 PE=1 SV=3
8	AFDB:Q9Y5Y6	0.232	0.281	8.193E-34	855	0.143	0.174	Q9Y5Y6.pdb.gz	ST14_HUMAN Suppressor of tumorigenicity 14 protein OS=Homo sapiens OX=9606 GN=ST14 PE=1 SV=2
9	AFDB:Q9JIQ8	0.272	0.538	1.568E-33	490	0.137	0.292	Q9JIQ8.pdb.gz	TMPS2_MOUSE Transmembrane protease serine 2 OS=Mus musculus OX=10090 GN=Tmprss2 PE=2 SV=3
10	AFDB:P56677	0.230	0.279	4.381E-33	855	0.133	0.163	P56677.pdb.gz	ST14_MOUSE Suppressor of tumorigenicity 14 protein homolog OS=Mus musculus OX=10090 GN=St14 PE=1 SV=2
11	PDB:1cgiE	0.208	0.855	1.162E-24	245	0.085	0.363	1cgiE.pdb.gz
12	PDB:4bnrA	0.210	0.889	1.256E-23	237	0.080	0.350	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
13	PDB:4h4fA	0.212	0.896	2.043E-23	239	0.080	0.347	4h4fA.pdb.gz	Long-range Electrostatic Complementarity Governs Substrate Recognition by Human Chymotrypsin C, a Key Regulator of Digestive Enzyme Activation.
14	PDB:6i44A	0.212	0.367	2.826E-23	594	0.087	0.153	6i44A.pdb.gz	Plasma kallikrein structure reveals apple domain disc rotated conformation compared to factor XI.
15	PDB:1fiwA	0.217	0.835	3.704E-23	260	0.077	0.308	1fiwA.pdb.gz	Effector sites in the three-dimensional structure of mammalian sperm beta-acrosin.
16	PDB:2zghA	0.205	0.884	1.285E-22	231	0.079	0.355	2zghA.pdb.gz	Structural basis for proteolytic specificity of the human apoptosis-inducing granzyme M
17	PDB:5i25A	0.212	0.362	1.432E-22	596	0.095	0.166	5i25A.pdb.gz	A novel DFP tripeptide motif interacts with the coagulation factor XI apple 2 domain.
18	PDB:2a7jA	0.209	0.875	1.511E-22	240	0.077	0.333	2a7jA.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
19	PDB:2ra3A	0.205	0.921	1.777E-22	224	0.079	0.366	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
20	PDB:1a0lA	0.204	0.838	2.596E-22	244	0.082	0.348	1a0lA.pdb.gz	Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X1D5	0.0	1704	938	0.803	0.892	A0A087X1D5_HUMAN Corin, serine peptidase OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=1
2	E7EQE7	0.0	1872	903	0.867	1.000	E7EQE7_HUMAN Corin, serine peptidase OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=1
3	J3KR88	0.0	1939	975	0.917	0.981	J3KR88_HUMAN Corin, serine peptidase OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=1
4	J3KR90	0.0	1941	1005	0.935	0.969	J3KR90_HUMAN Corin, serine peptidase OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=1
5	Q80YN4	0.0	1684	1111	0.813	0.762	CORIN_RAT Atrial natriuretic peptide-converting enzyme OS=Rattus norvegicus OX=10116 GN=Corin PE=1 SV=2
6	Q9Y5Q5	0.0	2154	1042	1.000	1.000	CORIN_HUMAN Atrial natriuretic peptide-converting enzyme OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=2
7	Q9Z319	0.0	1713	1113	0.821	0.769	CORIN_MOUSE Atrial natriuretic peptide-converting enzyme OS=Mus musculus OX=10090 GN=Corin PE=2 SV=2
8	Q9JIQ8	1.25e-63	226	490	0.144	0.306	TMPS2_MOUSE Transmembrane protease serine 2 OS=Mus musculus OX=10090 GN=Tmprss2 PE=2 SV=3
9	P98073	5.29e-60	225	1019	0.131	0.134	ENTK_HUMAN Enteropeptidase OS=Homo sapiens OX=9606 GN=TMPRSS15 PE=1 SV=3
10	P98072	8.80e-60	225	1035	0.131	0.131	ENTK_BOVIN Enteropeptidase OS=Bos taurus OX=9913 GN=TMPRSS15 PE=1 SV=1
11	C9JKZ3	1.02e-59	215	489	0.132	0.282	C9JKZ3_HUMAN Transmembrane protease serine 2 (Fragment) OS=Homo sapiens OX=9606 GN=TMPRSS2 PE=1 SV=1
12	O15393	1.18e-59	214	492	0.132	0.280	TMPS2_HUMAN Transmembrane protease serine 2 OS=Homo sapiens OX=9606 GN=TMPRSS2 PE=1 SV=3
13	C9J5Y1	1.56e-53	196	452	0.116	0.268	C9J5Y1_HUMAN Transmembrane serine protease 2 OS=Homo sapiens OX=9606 GN=TMPRSS2 PE=1 SV=2
14	Q5U405	2.69e-52	195	543	0.128	0.245	TMPSD_MOUSE Transmembrane protease serine 13 OS=Mus musculus OX=10090 GN=Tmprss13 PE=2 SV=2
15	P56677	5.65e-52	199	855	0.128	0.156	ST14_MOUSE Suppressor of tumorigenicity 14 protein homolog OS=Mus musculus OX=10090 GN=St14 PE=1 SV=2
16	Q80X17	6.42e-52	187	331	0.103	0.323	Q80X17_MOUSE Tryptase 5 OS=Mus musculus OX=10090 GN=Prss32 PE=2 SV=1
17	Q8R1A6	6.48e-52	187	331	0.103	0.323	Q8R1A6_MOUSE Protease, serine, 32 OS=Mus musculus OX=10090 GN=Prss32 PE=2 SV=1
18	Q9Y5Y6	6.89e-52	199	855	0.131	0.160	ST14_HUMAN Suppressor of tumorigenicity 14 protein OS=Homo sapiens OX=9606 GN=ST14 PE=1 SV=2
19	E9Q409	1.01e-51	187	334	0.103	0.320	E9Q409_MOUSE Protease, serine 32 OS=Mus musculus OX=10090 GN=Prss32 PE=1 SV=1
20	Q8K1T0	1.29e-51	190	453	0.119	0.274	TMPS3_MOUSE Transmembrane protease serine 3 OS=Mus musculus OX=10090 GN=Tmprss3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09342 DUF1986	1.3e+02	14.4	Domain of unknown function (DUF1986)
2	PF01392 Fz	7e-43	157.3	Fz domain
3	PF00057 Ldl_recept_a	1.8e-56	199.3	Low-density lipoprotein receptor domain class A
4	PF15494 SRCR_2	2e-06	39.7	Scavenger receptor cysteine-rich domain
5	PF15102 TMEM154	5.2e+02	11.8	TMEM154 protein family
6	PF00089 Trypsin	3.8e-57	205.2	Trypsin
7	PF13365 Trypsin_2	0.00063	32.2	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273857

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365663	0.971	Natriuretic peptides A
2	9606.ENSP00000265441	0.691	Protein Wnt-2
3	9606.ENSP00000483552	0.674	Furin
4	9606.ENSP00000357669	0.661	Atrial natriuretic peptide receptor 1
5	9606.ENSP00000273286	0.655	Leucine rich repeats and transmembrane domains 1
6	9606.ENSP00000363571	0.655	Muscle, skeletal receptor tyrosine-protein kinase
7	9606.ENSP00000365651	0.619	Natriuretic peptides B
8	9606.ENSP00000265074	0.602	Atrial natriuretic peptide receptor 3
9	9606.ENSP00000482760	0.579	Proprotein convertase subtilisin/kexin type 6
10	9606.ENSP00000340226	0.578	LIM homeobox transcription factor 1-alpha
11	9606.ENSP00000483721	0.574	Pituitary adenylate cyclase-activating polypeptide type I receptor
12	9606.ENSP00000290650	0.573	E3 ubiquitin-protein ligase UBR1
13	9606.ENSP00000387159	0.570	C-type natriuretic peptide
14	9606.ENSP00000368169	0.567	Segment polarity protein dishevelled homolog DVL-1
15	9606.ENSP00000262039	0.547	Phosphatidylinositol 3-kinase catalytic subunit type 3
16	9606.ENSP00000293549	0.536	Proto-oncogene Wnt-1
17	9606.ENSP00000378854	0.535	Phosphoserine phosphatase
18	9606.ENSP00000477949	0.530	Transmembrane protease serine 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004252	1.000	serine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0032501	0.988	multicellular organismal process
GO:0071704	0.988	organic substance metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0044238	0.974	primary metabolic process
GO:0065008	0.971	regulation of biological quality
GO:1901564	0.964	organonitrogen compound metabolic process
GO:0008217	0.962	regulation of blood pressure
GO:0016485	0.951	protein processing
GO:0044057	0.947	regulation of system process
GO:0044703	0.848	multi-organism reproductive process
GO:0007565	0.844	female pregnancy
GO:0043603	0.783	amide metabolic process
GO:0042445	0.777	hormone metabolic process
GO:0140448	0.754	signaling receptor ligand precursor processing
GO:0016486	0.715	peptide hormone processing
GO:0050794	0.640	regulation of cellular process
GO:0050886	0.592	endocrine process
GO:0001990	0.572	regulation of systemic arterial blood pressure by hormone
GO:0009987	0.562	cellular process
GO:0048518	0.440	positive regulation of biological process
GO:0050896	0.342	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005654	0.997	nucleoplasm
GO:0016604	0.983	nuclear body
GO:0043228	0.981	non-membrane-bounded organelle
GO:0015629	0.974	actin cytoskeleton
GO:0005737	0.715	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	1.000	Serine endopeptidases.

[back to server]