StarFunc result for job id Q9Y5Q8

User Input

>input (519 residues)
MAAEAADLGLGAAVPVELRRERRMVCVEYPGVVRDVAKMLPTLGGEEGVSRIYADPTKRL
ELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTI
YKFQGMSDFQYLAVHTEAGGKHTSMYDKVLMLRPEKEAFFHQELPLYIPPPIFSRLDAPV
DYFYRPETQHREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRR
VCTNPVDRKVEEELRKLFDIRPIWSRNAVKANISVHPDKLKVLLPFIAYYMITGPWRSLW
IRFGYDPRKNPDAKIYQVLDFRIRCGMKHGYAPSDLPVKAKRSTYNYSLPITVKKTSSQL
VTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQK
IIHRNDGAENSCTERDGWCLPKTSDELRDTMSLMIRQTIRSKRPALFSSSAKADGGKEQL
TYESGEDEEDEEEEEEEEEDFKPSDGSENEMETEILDYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5Q8	1.000	1.000	0.000	519	1.000	1.000	Q9Y5Q8.pdb.gz	TF3C5_HUMAN General transcription factor 3C polypeptide 5 OS=Homo sapiens OX=9606 GN=GTF3C5 PE=1 SV=2
2	AFDB:Q8R2T8	0.845	0.844	2.096E-88	520	0.854	0.852	Q8R2T8.pdb.gz	TF3C5_MOUSE General transcription factor 3C polypeptide 5 OS=Mus musculus OX=10090 GN=Gtf3c5 PE=2 SV=2
3	AFDB:Q5T7U1	0.462	0.510	8.836E-70	457	0.865	0.982	Q5T7U1.pdb.gz	Q5T7U1_HUMAN General transcription factor IIIC subunit 5 OS=Homo sapiens OX=9606 GN=GTF3C5 PE=1 SV=1
4	AFDB:O14229	0.346	0.379	1.192E-22	456	0.195	0.221	O14229.pdb.gz	SFC1_SCHPO Transcription factor tau subunit sfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sfc1 PE=1 SV=2
5	AFDB:P32367	0.334	0.272	1.799E-18	649	0.212	0.169	P32367.pdb.gz	TFC1_YEAST Transcription factor tau 95 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFC1 PE=1 SV=1
6	PDB:6yj6B	0.355	0.361	1.088E-15	508	0.181	0.185	6yj6B.pdb.gz
7	AFDB:Q38CE2	0.345	0.283	1.370E-12	647	0.129	0.104	Q38CE2.pdb.gz	Q38CE2_TRYB2 Transcription factor IIIC subunit 5 HTH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7170 PE=4 SV=1
8	PDB:7o4iR	0.108	0.199	2.746E-4	268	0.081	0.157	7o4iR.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
9	AFDB:P41900	0.126	0.207	3.168E-3	277	0.069	0.130	P41900.pdb.gz	T2FB_DROME General transcription factor IIF subunit 2 OS=Drosophila melanogaster OX=7227 GN=TfIIFbeta PE=2 SV=2
10	PDB:6o9lT	0.109	0.217	3.327E-3	237	0.064	0.139	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
11	AFDB:P41896	0.109	0.140	4.801E-3	400	0.079	0.102	P41896.pdb.gz	T2FB_YEAST Transcription initiation factor IIF subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFG2 PE=1 SV=2
12	AFDB:A0A024RDU9	0.113	0.229	6.551E-2	249	0.066	0.137	A0A024RDU9.pdb.gz
13	AFDB:Q969F1	0.095	0.187	7.378E-2	213	0.048	0.117	Q969F1.pdb.gz	TF3C6_HUMAN General transcription factor 3C polypeptide 6 OS=Homo sapiens OX=9606 GN=GTF3C6 PE=1 SV=1
14	PDB:3pufI	0.109	0.312	1.490E-1	140	0.037	0.136	3pufI.pdb.gz
15	PDB:7a6hN	0.077	0.158	1.889E-1	186	0.027	0.075	7a6hN.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
16	PDB:5svag	0.105	0.298	2.127E-1	172	0.054	0.163	5svag.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
17	PDB:7edxG	0.080	0.224	3.224E-1	145	0.019	0.069	7edxG.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
18	PDB:5fywR	0.103	0.260	3.631E-1	199	0.079	0.206	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
19	PDB:6s1cB	0.083	0.115	4.605E-1	342	0.021	0.032	6s1cB.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
20	PDB:6s1cF	0.106	0.163	4.887E-1	299	0.071	0.124	6s1cF.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7BY84	0.0	682	345	0.632	0.951	H7BY84_HUMAN General transcription factor IIIC subunit 5 OS=Homo sapiens OX=9606 GN=GTF3C5 PE=1 SV=2
2	Q5T7U1	0.0	777	457	0.778	0.884	Q5T7U1_HUMAN General transcription factor IIIC subunit 5 OS=Homo sapiens OX=9606 GN=GTF3C5 PE=1 SV=1
3	Q8R2T8	0.0	882	520	0.854	0.852	TF3C5_MOUSE General transcription factor 3C polypeptide 5 OS=Mus musculus OX=10090 GN=Gtf3c5 PE=2 SV=2
4	Q9Y5Q8	0.0	1078	519	1.000	1.000	TF3C5_HUMAN General transcription factor 3C polypeptide 5 OS=Homo sapiens OX=9606 GN=GTF3C5 PE=1 SV=2
5	Q5T7U4	3.15e-179	504	244	0.462	0.984	Q5T7U4_HUMAN General transcription factor IIIC subunit 5 (Fragment) OS=Homo sapiens OX=9606 GN=GTF3C5 PE=1 SV=1
6	Q5T7U0	7.57e-168	475	224	0.432	1.000	Q5T7U0_HUMAN General transcription factor IIIC subunit 5 (Fragment) OS=Homo sapiens OX=9606 GN=GTF3C5 PE=1 SV=1
7	O14229	1.17e-25	111	456	0.177	0.202	SFC1_SCHPO Transcription factor tau subunit sfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sfc1 PE=1 SV=2
8	P32367	7.22e-07	54.3	649	0.052	0.042	TFC1_YEAST Transcription factor tau 95 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFC1 PE=1 SV=1
9	Q38CE2	0.51	35.4	647	0.050	0.040	Q38CE2_TRYB2 Transcription factor IIIC subunit 5 HTH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7170 PE=4 SV=1
10	O60164	1.1	34.7	607	0.039	0.033	PESC_SCHPO Pescadillo homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppp1 PE=1 SV=1
11	D2CSU5	9.6	30.8	263	0.050	0.099	CM2_PETHY Chorismate mutase 2 OS=Petunia hybrida OX=4102 GN=CM2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09734 Tau95	4.4e-36	136.2	RNA polymerase III transcription factor (TF)IIIC subunit HTH domain
2	PF17682 Tau95_N	7.6e-26	102.3	Tau95 Triple barrel domain
3	PF02270 TFIIF_beta	5.3e+02	12.2	TFIIF, beta subunit HTH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361180

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263956	0.999	General transcription factor 3C polypeptide 3
2	9606.ENSP00000348510	0.998	General transcription factor 3C polypeptide 1
3	9606.ENSP00000361219	0.998	General transcription factor 3C polypeptide 4
4	9606.ENSP00000357863	0.994	General transcription factor 3C polypeptide 6
5	9606.ENSP00000352536	0.993	General transcription factor 3C polypeptide 2
6	9606.ENSP00000448323	0.990	Transcription factor IIIB 90 kDa subunit
7	9606.ENSP00000351575	0.984	Transcription factor TFIIIB component B'' homolog
8	9606.ENSP00000334564	0.910	DNA-directed RNA polymerase III subunit RPC3
9	9606.ENSP00000231509	0.900	Glucocorticoid receptor
10	9606.ENSP00000361446	0.879	DNA-directed RNA polymerase III subunit RPC1
11	9606.ENSP00000380904	0.879	DNA-directed RNA polymerase III subunit RPC4
12	9606.ENSP00000375942	0.865	TATA-box-binding protein
13	9606.ENSP00000378181	0.838	Bromodomain-containing protein 7
14	9606.ENSP00000366828	0.826	DNA-directed RNA polymerase III subunit RPC6
15	9606.ENSP00000378307	0.826	Protein polybromo-1
16	9606.ENSP00000220659	0.809	Transcription factor IIIB 50 kDa subunit
17	9606.ENSP00000382058	0.796	DNA-directed RNA polymerase III subunit RPC7
18	9606.ENSP00000342889	0.794	DNA-directed RNA polymerases I, II, and III subunit RPABC4
19	9606.ENSP00000299853	0.790	DNA-directed RNA polymerase III subunit RPC5
20	9606.ENSP00000228347	0.780	DNA-directed RNA polymerase III subunit RPC2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000995	1.000	RNA polymerase III general transcription initiation factor activity
GO:0003677	1.000	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0006351	0.989	DNA-templated transcription
GO:0006383	0.961	transcription by RNA polymerase III
GO:0034660	0.914	ncRNA metabolic process
GO:0098781	0.907	ncRNA transcription
GO:0016072	0.824	rRNA metabolic process
GO:0009303	0.754	rRNA transcription
GO:0006399	0.615	tRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.997	protein-containing complex
GO:0005667	0.925	transcription regulator complex
GO:0090576	0.768	RNA polymerase III transcription regulator complex
GO:0000127	0.384	transcription factor TFIIIC complex
GO:0005737	0.323	cytoplasm
GO:0043228	0.310	non-membrane-bounded organelle
GO:0043232	0.300	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]