StarFunc result for job id Q9Y5Q9

User Input

>input (886 residues)
MSGFSPELIDYLEGKISFEEFERRREERKTREKKSLQEKGKLSAEENPDDSEVPSSSGIN
STKSQDKDVNEGETSDGVRKSVHKVFASMLGENEDDEEEEEEEEEEEEEEETPEQPTAGD
VFVLEMVLNRETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAP
LAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCY
TKALKYEPTNVRYLWERSSLYEQMGDHKMAMDGYRRILNLLSPSDGERFMQLARDMAKSY
YEANDVTSAINIIDEAFSKHQGLVSMEDVNIAAELYISNKQYDKALEIITDFSGIVLEKK
TSEEGTSEENKAPENVTCTIPDGVPIDITVKLMVCLVHLNILEPLNPLLTTLVEQNPEDM
GDLYLDVAEAFLDVGEYNSALPLLSALVCSERYNLAVVWLRHAECLKALGYMERAAESYG
KVVDLAPLHLDARISLSTLQQQLGQPEKALEALEPMYDPDTLAQDANAAQQELKLLLHRS
TLLFSQGKMYGYVDTLLTMLAMLLKVAMNRAQVCLISSSKSGERHLYLIKVSRDKISDSN
DQESANCDAKAIFAVLTSVLTKDDWWNLLLKAIYSLCDLSRFQEAELLVDSSLEYYSFYD
DRQKRKELEYFGLSAAILDKNFRKAYNYIRIMVMENVNKPQLWNIFNQVTMHSQDVRHHR
FCLRLMLKNPENHALCVLNGHNAFVSGSFKHALGQYVQAFRTHPDEPLYSFCIGLTFIHM
ASQKYVLRRHALIVQGFSFLNRYLSLRGPCQESFYNLGRGLHQLGLIHLAIHYYQKALEL
PPLVVEGIELDQLDLRRDIAYNLSLIYQSSGNTGMAQTLLYTYCSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5Q9	1.000	1.000	1.549E-103	886	1.000	1.000	Q9Y5Q9.pdb.gz	TF3C3_HUMAN General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3 PE=1 SV=1
2	AFDB:P33339	0.320	0.282	2.497E-25	1025	0.201	0.174	P33339.pdb.gz	TFC4_YEAST Transcription factor tau 131 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFC4 PE=1 SV=1
3	AFDB:O74458	0.315	0.282	6.920E-25	1006	0.223	0.197	O74458.pdb.gz	SFC4_SCHPO Transcription factor tau subunit sfc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sfc4 PE=1 SV=1
4	PDB:6yj6A	0.301	0.323	2.219E-23	819	0.196	0.212	6yj6A.pdb.gz
5	AFDB:Q57WP4	0.239	0.301	3.142E-15	673	0.106	0.140	Q57WP4.pdb.gz	Q57WP4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.910 PE=4 SV=1
6	AFDB:Q6NNB2	0.184	0.147	5.748E-15	1233	0.112	0.080	Q6NNB2.pdb.gz	Q6NNB2_DROME LP07472p OS=Drosophila melanogaster OX=7227 GN=SKI3 PE=1 SV=1
7	AFDB:P17883	0.182	0.124	2.602E-14	1432	0.138	0.085	P17883.pdb.gz	SKI3_YEAST Superkiller protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI3 PE=1 SV=2
8	AFDB:Q96AY4	0.221	0.088	1.178E-13	2481	0.129	0.046	Q96AY4.pdb.gz	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
9	AFDB:Q7KJA9	0.238	0.205	3.144E-13	1059	0.102	0.085	Q7KJA9.pdb.gz	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
10	AFDB:B5X0I6	0.204	0.172	4.252E-13	1091	0.123	0.100	B5X0I6.pdb.gz	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
11	AFDB:O18158	0.225	0.180	4.252E-13	1151	0.112	0.086	O18158.pdb.gz	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
12	PDB:4bujB	0.180	0.125	1.264E-12	1367	0.115	0.075	4bujB.pdb.gz
13	PDB:6c95A	0.221	0.247	1.047E-10	773	0.133	0.153	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
14	PDB:7dkhI	0.204	0.199	1.129E-10	914	0.122	0.118	7dkhI.pdb.gz
15	PDB:7qdrB	0.187	0.144	3.129E-10	1212	0.151	0.111	7qdrB.pdb.gz
16	PDB:5nrlJ	0.169	0.184	3.130E-9	800	0.122	0.135	5nrlJ.pdb.gz	Structure of a pre-catalytic spliceosome.
17	PDB:4kvmB	0.146	0.168	3.506E-9	722	0.098	0.120	4kvmB.pdb.gz	Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
18	PDB:7ntfA	0.201	0.196	9.355E-9	918	0.104	0.100	7ntfA.pdb.gz
19	PDB:4xnhA	0.187	0.206	1.173E-8	786	0.098	0.111	4xnhA.pdb.gz	Crystal structure of yeast N-terminal acetyltransferase NatE (IP6) in complex with a bisubstrate
20	PDB:6bq1B	0.184	0.218	1.265E-8	728	0.116	0.141	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y5Q9	0.0	1834	886	1.000	1.000	TF3C3_HUMAN General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3 PE=1 SV=1
2	O74458	6.27e-22	104	1006	0.094	0.083	SFC4_SCHPO Transcription factor tau subunit sfc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sfc4 PE=1 SV=1
3	P33339	9.38e-18	90.9	1025	0.055	0.048	TFC4_YEAST Transcription factor tau 131 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFC4 PE=1 SV=1
4	Q9M8Y0	1.04e-06	55.1	977	0.042	0.038	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
5	B5X0I6	4.11e-06	53.1	1091	0.056	0.046	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
6	Q9Y148	3.52e-05	50.1	1011	0.058	0.050	Q9Y148_DROME protein O-GlcNAc transferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=sxc PE=2 SV=1
7	Q7KJA9	3.72e-05	50.1	1059	0.058	0.048	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
8	A0A0R4IVJ0	1.20e-04	48.5	1102	0.038	0.031	A0A0R4IVJ0_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=ogt.2 PE=1 SV=1
9	P56558	1.35e-04	48.1	1036	0.037	0.032	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
10	Q5GA13	1.35e-04	48.1	1062	0.037	0.031	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
11	Q5GA10	1.43e-04	48.1	1036	0.037	0.032	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
12	Q5GA12	1.44e-04	48.1	1052	0.037	0.031	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
13	Q8CGY8	1.51e-04	48.1	1046	0.037	0.032	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
14	O15294	1.56e-04	48.1	1046	0.037	0.032	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
15	Q726A1	1.58e-04	46.2	207	0.035	0.150	Q726A1_DESVH TPR domain protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_3272 PE=1 SV=1
16	P81436	1.60e-04	48.1	1046	0.037	0.032	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
17	Q5GA11	1.64e-04	48.1	1046	0.037	0.032	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
18	Q61371	3.72e-04	46.6	824	0.036	0.039	IFT88_MOUSE Intraflagellar transport protein 88 homolog OS=Mus musculus OX=10090 GN=Ift88 PE=1 SV=2
19	D4ACI9	3.80e-04	46.6	788	0.033	0.037	D4ACI9_RAT Intraflagellar transport 88 OS=Rattus norvegicus OX=10116 GN=Ift88 PE=4 SV=2
20	O18158	0.002	44.3	1151	0.043	0.033	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	1.1e-06	40.1	Anaphase-promoting complex, cyclosome, subunit 3
2	PF16266 DUF4919	1.3e+02	13.8	Domain of unknown function (DUF4919)
3	PF04781 DUF627	82	14.6	Protein of unknown function (DUF627)
4	PF11817 Foie-gras_1	5e+02	11.7	Foie gras liver health family 1
5	PF08238 Sel1	4.2e+02	13.1	Sel1 repeat
6	PF10516 SHNi-TPR	10	17.0	SHNi-TPR
7	PF00515 TPR_1	3.3e-14	63.2	Tetratricopeptide repeat
8	PF13374 TPR_10	4.3e+02	12.2	Tetratricopeptide repeat
9	PF13414 TPR_11	0.00022	32.1	TPR repeat
10	PF13424 TPR_12	0.0005	31.6	Tetratricopeptide repeat
11	PF13428 TPR_14	1.6e-08	45.7	Tetratricopeptide repeat
12	PF13429 TPR_15	0.00074	30.5	Tetratricopeptide repeat
13	PF13432 TPR_16	0.0001	34.1	Tetratricopeptide repeat
14	PF13431 TPR_17	0.036	25.5	Tetratricopeptide repeat
15	PF14559 TPR_19	5.6e-08	44.5	Tetratricopeptide repeat
16	PF07719 TPR_2	2.8e-17	72.4	Tetratricopeptide repeat
17	PF14561 TPR_20	0.047	25.3	Tetratricopeptide repeat
18	PF07721 TPR_4	43	16.1	Tetratricopeptide repeat
19	PF13174 TPR_6	5e-05	34.8	Tetratricopeptide repeat
20	PF13176 TPR_7	3.9e-07	40.7	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263956

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361180	0.999	General transcription factor 3C polypeptide 5
2	9606.ENSP00000448323	0.998	Transcription factor IIIB 90 kDa subunit
3	9606.ENSP00000361219	0.997	General transcription factor 3C polypeptide 4
4	9606.ENSP00000348510	0.996	General transcription factor 3C polypeptide 1
5	9606.ENSP00000351575	0.995	Transcription factor TFIIIB component B'' homolog
6	9606.ENSP00000352536	0.995	General transcription factor 3C polypeptide 2
7	9606.ENSP00000357863	0.986	General transcription factor 3C polypeptide 6
8	9606.ENSP00000298875	0.978	Cleavage and polyadenylation specificity factor subunit 2
9	9606.ENSP00000484669	0.976	Cleavage and polyadenylation specificity factor subunit 1
10	9606.ENSP00000220659	0.950	Transcription factor IIIB 50 kDa subunit
11	9606.ENSP00000334564	0.920	DNA-directed RNA polymerase III subunit RPC3
12	9606.ENSP00000361446	0.918	DNA-directed RNA polymerase III subunit RPC1
13	9606.ENSP00000231509	0.900	Glucocorticoid receptor
14	9606.ENSP00000380904	0.890	DNA-directed RNA polymerase III subunit RPC4
15	9606.ENSP00000375942	0.869	TATA-box-binding protein
16	9606.ENSP00000366828	0.858	DNA-directed RNA polymerase III subunit RPC6
17	9606.ENSP00000228347	0.854	DNA-directed RNA polymerase III subunit RPC2
18	9606.ENSP00000342889	0.849	DNA-directed RNA polymerases I, II, and III subunit RPABC4
19	9606.ENSP00000238112	0.822	Cleavage and polyadenylation specificity factor subunit 3
20	9606.ENSP00000245934	0.817	Symplekin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000995	1.000	RNA polymerase III general transcription initiation factor activity
GO:0003677	1.000	DNA binding
GO:0003824	0.432	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009303	0.994	rRNA transcription
GO:0006383	0.991	transcription by RNA polymerase III
GO:0006399	0.986	tRNA metabolic process
GO:0065007	0.409	biological regulation
GO:0050789	0.325	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0012505	0.997	endomembrane system
GO:0090576	0.992	RNA polymerase III transcription regulator complex
GO:0031090	0.992	organelle membrane
GO:0005730	0.987	nucleolus
GO:0031975	0.977	envelope
GO:0031967	0.961	organelle envelope
GO:0005737	0.950	cytoplasm
GO:0005635	0.950	nuclear envelope
GO:0031965	0.932	nuclear membrane
GO:0005829	0.870	cytosol
GO:0000127	0.725	transcription factor TFIIIC complex
GO:0140513	0.619	nuclear protein-containing complex
GO:1990234	0.312	transferase complex
GO:0140535	0.308	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]