StarFunc result for job id Q9Y5R5

User Input

>input (561 residues)
MADPQAGSAAGDWEIDVESLELEEDVCGAPRSTPPGPSPPPADGDCEDDEDDDGVDEDAE
EEGDGEEAGASPGMPGQPEQRGGPQPRPPLAPQASPAGTGPRERCTPAGGGAEPRKLSRT
PKCARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQQATEDKKGL
SGKQNNFERKAVYQRQVRAPSLLAKSILEGYRPIPAETYVGGTFPLPPPVSDRMRKRRAF
ADKELENIMLEREYKEREMLETSQAAALFLPNRMVPGPDYNSYKSAYSPSPVEPPSKDFC
NFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQCL
LNATTSVQALKPGASWDLKGARVQDGLSAEQDMMPSKLEGSLVLPHTPEIQTTRSDLQGH
QAVPERSAFSPPRRNFSPIVDTDSLAAQGHVLTKISKENTRHPLPLRHNPFHSLFQQTLT
DKSGPELKTPFVKEAFEETPKKHRECLVKDNQKYTFTIDRCAKDLFVAKQVGTKLSVNEP
LSFSVESILKRPSSAITRVSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5R5	0.999	0.999	2.113E-88	561	1.000	1.000	Q9Y5R5.pdb.gz	DMRT2_HUMAN Doublesex- and mab-3-related transcription factor 2 OS=Homo sapiens OX=9606 GN=DMRT2 PE=1 SV=2
2	AFDB:Q8BG36	0.270	0.270	5.927E-72	561	0.838	0.838	Q8BG36.pdb.gz	DMRT2_MOUSE Doublesex- and mab-3-related transcription factor 2 OS=Mus musculus OX=10090 GN=Dmrt2 PE=1 SV=1
3	AFDB:A0A2R8RK69	0.068	0.058	3.156E-5	685	0.125	0.102	A0A2R8RK69.pdb.gz
4	AFDB:P25389	0.070	0.045	4.725E-5	1037	0.112	0.061	P25389.pdb.gz	KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KCC4 PE=1 SV=3
5	AFDB:Q03213	0.064	0.053	7.074E-5	719	0.148	0.115	Q03213.pdb.gz	HOT1_YEAST High-osmolarity-induced transcription protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOT1 PE=1 SV=1
6	AFDB:Q582B7	0.071	0.060	1.814E-4	695	0.137	0.111	Q582B7.pdb.gz	Q582B7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.690 PE=4 SV=1
7	AFDB:P36417	0.064	0.054	2.075E-4	708	0.125	0.099	P36417.pdb.gz	GBF_DICDI G-box-binding factor OS=Dictyostelium discoideum OX=44689 GN=gbfA PE=1 SV=2
8	AFDB:Q13033	0.066	0.053	5.322E-4	797	0.119	0.084	Q13033.pdb.gz	STRN3_HUMAN Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3
9	AFDB:Q8I2B4	0.063	0.028	6.512E-4	1567	0.127	0.045	Q8I2B4.pdb.gz	Q8I2B4_PLAF7 Erythrocyte binding antigen-181 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0102500 PE=4 SV=1
10	AFDB:A1Z951	0.059	0.053	1.786E-3	639	0.114	0.100	A1Z951.pdb.gz	A1Z951_DROME MIP12871p OS=Drosophila melanogaster OX=7227 GN=CG12488 PE=2 SV=2
11	PDB:1ei3C	0.065	0.089	6.228	397	0.029	0.040	1ei3C.pdb.gz
12	PDB:3jd5O	0.046	0.132	6.661	173	0.034	0.110	3jd5O.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
13	PDB:7enal	0.060	0.210	7.125	126	0.045	0.198	7enal.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:7lbmh	0.057	0.188	9.973	158	0.036	0.127	7lbmh.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
15	PDB:7w59U	0.037	0.176	9.973	72	0.032	0.250	7w59U.pdb.gz	Mechanism of exon ligation by human spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BG36	0.0	897	561	0.843	0.843	DMRT2_MOUSE Doublesex- and mab-3-related transcription factor 2 OS=Mus musculus OX=10090 GN=Dmrt2 PE=1 SV=1
2	Q9Y5R5	0.0	1157	561	1.000	1.000	DMRT2_HUMAN Doublesex- and mab-3-related transcription factor 2 OS=Homo sapiens OX=9606 GN=DMRT2 PE=1 SV=2
3	Q9W7K3	1.23e-180	520	507	0.490	0.542	Q9W7K3_DANRE Doublesex and mab-3-related transcription factor 2a OS=Danio rerio OX=7955 GN=dmrt2 PE=2 SV=1
4	A0SDZ6	7.66e-61	207	364	0.191	0.294	A0SDZ6_DANRE Doublesex-and mab-3-related transcription factor 2b OS=Danio rerio OX=7955 GN=dmrt2b PE=2 SV=1
5	Q71MM5	6.55e-28	115	267	0.091	0.191	DMRT1_DANRE Doublesex- and mab-3-related transcription factor 1 OS=Danio rerio OX=7955 GN=dmrt1 PE=2 SV=1
6	Q5UU75	2.28e-27	117	440	0.087	0.111	DMTA2_DANRE Doublesex- and mab-3-related transcription factor A2 OS=Danio rerio OX=7955 GN=dmrta2 PE=2 SV=1
7	Q8CFG4	2.51e-27	117	490	0.111	0.127	DMRTA_MOUSE Doublesex- and mab-3-related transcription factor A1 OS=Mus musculus OX=10090 GN=Dmrta1 PE=2 SV=1
8	Q9PTQ7	2.85e-27	115	365	0.118	0.181	DMRT1_CHICK Doublesex- and mab-3-related transcription factor 1 OS=Gallus gallus OX=9031 GN=DMRT1 PE=2 SV=2
9	Q2MJB4	4.38e-27	116	437	0.087	0.112	DMTA2_XENLA Doublesex- and mab-3-related transcription factor A2 OS=Xenopus laevis OX=8355 GN=dmrta2 PE=2 SV=1
10	Q5VZB9	6.80e-27	116	504	0.094	0.105	DMRTA_HUMAN Doublesex- and mab-3-related transcription factor A1 OS=Homo sapiens OX=9606 GN=DMRTA1 PE=1 SV=1
11	Q9Y5R6	7.49e-27	114	373	0.091	0.137	DMRT1_HUMAN Doublesex- and mab-3-related transcription factor 1 OS=Homo sapiens OX=9606 GN=DMRT1 PE=1 SV=2
12	Q3LH63	1.18e-26	113	336	0.087	0.146	DMT1A_XENLA Doublesex- and mab-3-related transcription factor 1A OS=Xenopus laevis OX=8355 GN=dmrt1-a PE=1 SV=1
13	Q96SC8	1.39e-26	115	542	0.087	0.090	DMTA2_HUMAN Doublesex- and mab-3-related transcription factor A2 OS=Homo sapiens OX=9606 GN=DMRTA2 PE=2 SV=2
14	Q9QZ59	1.86e-26	113	374	0.087	0.131	DMRT1_MOUSE Doublesex- and mab-3-related transcription factor 1 OS=Mus musculus OX=10090 GN=Dmrt1 PE=1 SV=2
15	Q925A6	1.95e-26	113	374	0.087	0.131	Q925A6_RAT Doublesex and mab-3 related transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Dmrt1 PE=3 SV=1
16	Q9VYE0	1.95e-26	113	377	0.087	0.130	Q9VYE0_DROME Doublesex-Mab related 11E OS=Drosophila melanogaster OX=7227 GN=dmrt11E PE=4 SV=2
17	A2A9A2	3.12e-26	114	531	0.087	0.092	DMTA2_MOUSE Doublesex- and mab-3-related transcription factor A2 OS=Mus musculus OX=10090 GN=Dmrta2 PE=2 SV=1
18	P83758	7.40e-26	112	448	0.089	0.112	DMT3A_DANRE Doublesex- and mab-3-related transcription factor 3a OS=Danio rerio OX=7955 GN=dmrt3a PE=1 SV=2
19	J7FCF0	7.68e-26	109	300	0.084	0.157	DMR3T_HORSE Doublesex and mab-3 related transcription factor 3, truncated OS=Equus caballus OX=9796 GN=DMRT3 PE=2 SV=1
20	Q19291	1.22e-25	108	280	0.078	0.157	DMD5_CAEEL Doublesex- and mab-3-related transcription factor dmd-5 OS=Caenorhabditis elegans OX=6239 GN=dmd-5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00751 DM	2e-19	80.5	DM DNA binding domain
2	PF06586 TraK	40	15.2	TraK protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371686

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341826	0.691	Heterogeneous nuclear ribonucleoprotein A1
2	9606.ENSP00000350090	0.691	Heterogeneous nuclear ribonucleoprotein A1-like 2
3	9606.ENSP00000333188	0.673	Forkhead box protein L2
4	9606.ENSP00000337976	0.652	Histone-lysine N-methyltransferase SUV39H1
5	9606.ENSP00000276603	0.642	Telomeric repeat-binding factor 1
6	9606.ENSP00000309572	0.642	Telomerase reverse transcriptase
7	9606.ENSP00000362441	0.635	Transcriptional regulator ATRX
8	9606.ENSP00000383042	0.569	Lysine-specific histone demethylase 1A
9	9606.ENSP00000274496	0.567	Protein YIPF5
10	9606.ENSP00000398798	0.563	Zinc finger protein 142
11	9606.ENSP00000267415	0.544	TERF1-interacting nuclear factor 2
12	9606.ENSP00000360623	0.536	Origin recognition complex subunit 1
13	9606.ENSP00000477725	0.536	KN motif and ankyrin repeat domain-containing protein 1
14	9606.ENSP00000368253	0.518	Nuclear receptor subfamily 0 group B member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.998	DNA binding
GO:0043565	0.959	sequence-specific DNA binding
GO:0003690	0.928	double-stranded DNA binding
GO:1990837	0.911	sequence-specific double-stranded DNA binding
GO:0042802	0.831	identical protein binding
GO:0140110	0.826	transcription regulator activity
GO:0003700	0.597	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.990	developmental process
GO:0050794	0.987	regulation of cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0048856	0.969	anatomical structure development
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0019219	0.967	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.948	regulation of macromolecule biosynthetic process
GO:0031326	0.948	regulation of cellular biosynthetic process
GO:0007275	0.943	multicellular organism development
GO:0048522	0.942	positive regulation of cellular process
GO:0010468	0.935	regulation of gene expression
GO:0051252	0.934	regulation of RNA metabolic process
GO:0006355	0.900	regulation of DNA-templated transcription
GO:0010604	0.891	positive regulation of macromolecule metabolic process
GO:0051173	0.886	positive regulation of nitrogen compound metabolic process
GO:0031325	0.875	positive regulation of cellular metabolic process
GO:0045935	0.872	positive regulation of nucleobase-containing compound metabolic process
GO:0009987	0.815	cellular process
GO:0006357	0.782	regulation of transcription by RNA polymerase II
GO:0009891	0.776	positive regulation of biosynthetic process
GO:0031328	0.770	positive regulation of cellular biosynthetic process
GO:0010557	0.769	positive regulation of macromolecule biosynthetic process
GO:0045893	0.673	positive regulation of DNA-templated transcription
GO:0048731	0.423	system development
GO:0045944	0.378	positive regulation of transcription by RNA polymerase II
GO:0048523	0.367	negative regulation of cellular process
GO:0009888	0.323	tissue development
GO:0009790	0.309	embryo development
GO:0050793	0.302	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.376	intracellular organelle lumen
GO:0031981	0.373	nuclear lumen
GO:0005737	0.314	cytoplasm
GO:0005654	0.304	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]