StarFunc result for job id Q9Y5R6

User Input

>input (373 residues)
MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSSRGGGSGSGA
SDLGAGSKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVA
LRRQQAQEEELGISHPIPLPSAAELLVKRENNGSNPCLMTECSGTSQPPPASVPTTAASE
GRMVIQDIPAVTSRGHVENTPDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSA
SGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYL
GQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEP
SSFTVTPVIEEDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5R6	0.999	0.999	6.481E-56	373	1.000	1.000	Q9Y5R6.pdb.gz	DMRT1_HUMAN Doublesex- and mab-3-related transcription factor 1 OS=Homo sapiens OX=9606 GN=DMRT1 PE=1 SV=2
2	AFDB:Q925A6	0.326	0.326	9.554E-46	374	0.823	0.821	Q925A6.pdb.gz	Q925A6_RAT Doublesex and mab-3 related transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Dmrt1 PE=3 SV=1
3	AFDB:Q9PTQ7	0.312	0.318	2.332E-32	365	0.595	0.608	Q9PTQ7.pdb.gz	DMRT1_CHICK Doublesex- and mab-3-related transcription factor 1 OS=Gallus gallus OX=9031 GN=DMRT1 PE=2 SV=2
4	AFDB:Q3LH63	0.271	0.298	1.739E-31	336	0.590	0.655	Q3LH63.pdb.gz	DMT1A_XENLA Doublesex- and mab-3-related transcription factor 1A OS=Xenopus laevis OX=8355 GN=dmrt1-a PE=1 SV=1
5	AFDB:Q71MM5	0.287	0.386	2.709E-16	267	0.365	0.509	Q71MM5.pdb.gz	DMRT1_DANRE Doublesex- and mab-3-related transcription factor 1 OS=Danio rerio OX=7955 GN=dmrt1 PE=2 SV=1
6	AFDB:Q8CFG4	0.175	0.134	1.386E-9	490	0.300	0.229	Q8CFG4.pdb.gz	DMRTA_MOUSE Doublesex- and mab-3-related transcription factor A1 OS=Mus musculus OX=10090 GN=Dmrta1 PE=2 SV=1
7	AFDB:A2A9I7	0.159	0.165	2.825E-6	359	0.204	0.212	A2A9I7.pdb.gz	DMRTB_MOUSE Doublesex- and mab-3-related transcription factor B1 OS=Mus musculus OX=10090 GN=Dmrtb1 PE=1 SV=1
8	AFDB:B3DH92	0.088	0.050	2.643E-2	820	0.161	0.073	B3DH92.pdb.gz	B3DH92_DANRE Clock circadian regulator b OS=Danio rerio OX=7955 GN=clock3 PE=2 SV=1
9	AFDB:Q06453	0.084	0.079	4.601E-2	408	0.169	0.154	Q06453.pdb.gz	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
10	AFDB:O62011	0.112	0.047	6.971E-2	1054	0.188	0.066	O62011.pdb.gz	O62011_CAEEL MUTator OS=Caenorhabditis elegans OX=6239 GN=mut-16 PE=1 SV=4
11	PDB:1rquA	0.075	0.162	5.315	120	0.029	0.092	1rquA.pdb.gz
12	PDB:6c24C	0.086	0.191	5.697	148	0.032	0.081	6c24C.pdb.gz	Structures of human PRC2 with its cofactors AEBP2 and JARID2.
13	PDB:5ds9B	0.076	0.142	6.543	98	0.027	0.102	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.
14	PDB:7qsoh	0.094	0.232	8.054	143	0.038	0.098	7qsoh.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
15	PDB:7pntZ	0.072	0.215	8.632	101	0.024	0.089	7pntZ.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
16	PDB:6v8oO	0.069	0.067	9.251	384	0.024	0.023	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
17	PDB:7r5jV0	0.088	0.119	9.914	273	0.038	0.051	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q925A6	0.0	531	374	0.807	0.805	Q925A6_RAT Doublesex and mab-3 related transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Dmrt1 PE=3 SV=1
2	Q9QZ59	0.0	524	374	0.812	0.810	DMRT1_MOUSE Doublesex- and mab-3-related transcription factor 1 OS=Mus musculus OX=10090 GN=Dmrt1 PE=1 SV=2
3	Q9Y5R6	0.0	760	373	1.000	1.000	DMRT1_HUMAN Doublesex- and mab-3-related transcription factor 1 OS=Homo sapiens OX=9606 GN=DMRT1 PE=1 SV=2
4	Q3LH63	7.06e-136	392	336	0.590	0.655	DMT1A_XENLA Doublesex- and mab-3-related transcription factor 1A OS=Xenopus laevis OX=8355 GN=dmrt1-a PE=1 SV=1
5	Q9PTQ7	1.09e-126	370	365	0.579	0.592	DMRT1_CHICK Doublesex- and mab-3-related transcription factor 1 OS=Gallus gallus OX=9031 GN=DMRT1 PE=2 SV=2
6	Q71MM5	1.11e-53	180	267	0.335	0.468	DMRT1_DANRE Doublesex- and mab-3-related transcription factor 1 OS=Danio rerio OX=7955 GN=dmrt1 PE=2 SV=1
7	B0I1G7	4.99e-47	160	194	0.201	0.387	DMW_XENLA Doublesex- and mab-3-related transcription factor DM-W OS=Xenopus laevis OX=8355 GN=dm-w PE=1 SV=1
8	Q8JIR6	2.79e-45	158	267	0.314	0.438	DMT1Y_ORYLA Doublesex- and mab-3-related transcription factor 1Y OS=Oryzias latipes OX=8090 GN=dmrt1y PE=2 SV=1
9	Q5UU75	4.19e-29	119	440	0.134	0.114	DMTA2_DANRE Doublesex- and mab-3-related transcription factor A2 OS=Danio rerio OX=7955 GN=dmrta2 PE=2 SV=1
10	Q5VZB9	9.74e-29	119	504	0.158	0.117	DMRTA_HUMAN Doublesex- and mab-3-related transcription factor A1 OS=Homo sapiens OX=9606 GN=DMRTA1 PE=1 SV=1
11	Q2MJB4	9.79e-29	118	437	0.134	0.114	DMTA2_XENLA Doublesex- and mab-3-related transcription factor A2 OS=Xenopus laevis OX=8355 GN=dmrta2 PE=2 SV=1
12	Q8CFG4	1.28e-28	118	490	0.145	0.110	DMRTA_MOUSE Doublesex- and mab-3-related transcription factor A1 OS=Mus musculus OX=10090 GN=Dmrta1 PE=2 SV=1
13	Q19291	2.58e-28	114	280	0.129	0.171	DMD5_CAEEL Doublesex- and mab-3-related transcription factor dmd-5 OS=Caenorhabditis elegans OX=6239 GN=dmd-5 PE=1 SV=2
14	Q9W7K3	2.64e-28	117	507	0.150	0.110	Q9W7K3_DANRE Doublesex and mab-3-related transcription factor 2a OS=Danio rerio OX=7955 GN=dmrt2 PE=2 SV=1
15	Q96SC8	4.54e-28	117	542	0.134	0.092	DMTA2_HUMAN Doublesex- and mab-3-related transcription factor A2 OS=Homo sapiens OX=9606 GN=DMRTA2 PE=2 SV=2
16	A2A9A2	9.17e-28	116	531	0.134	0.094	DMTA2_MOUSE Doublesex- and mab-3-related transcription factor A2 OS=Mus musculus OX=10090 GN=Dmrta2 PE=2 SV=1
17	Q8BG36	1.21e-27	116	561	0.145	0.096	DMRT2_MOUSE Doublesex- and mab-3-related transcription factor 2 OS=Mus musculus OX=10090 GN=Dmrt2 PE=1 SV=1
18	Q9Y5R5	1.21e-27	116	561	0.166	0.111	DMRT2_HUMAN Doublesex- and mab-3-related transcription factor 2 OS=Homo sapiens OX=9606 GN=DMRT2 PE=1 SV=2
19	A0SDZ6	4.66e-25	106	364	0.129	0.132	A0SDZ6_DANRE Doublesex-and mab-3-related transcription factor 2b OS=Danio rerio OX=7955 GN=dmrt2b PE=2 SV=1
20	Q18248	1.85e-24	102	260	0.118	0.169	DMD4_CAEEL Doublesex- and mab-3-related transcription factor dmd-4 OS=Caenorhabditis elegans OX=6239 GN=dmd-4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00751 DM	5e-19	79.3	DM DNA binding domain
2	PF12374 Dmrt1	3.8e-30	115.4	Double-sex mab3 related transcription factor 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371711

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245479	0.974	Transcription factor SOX-9
2	9606.ENSP00000334458	0.955	Transcription factor GATA-4
3	9606.ENSP00000221496	0.915	Muellerian-inhibiting factor
4	9606.ENSP00000362690	0.890	Steroidogenic factor 1
5	9606.ENSP00000333188	0.887	Forkhead box protein L2
6	9606.ENSP00000266991	0.857	Desert hedgehog protein
7	9606.ENSP00000477725	0.820	KN motif and ankyrin repeat domain-containing protein 1
8	9606.ENSP00000379683	0.788	Aromatase
9	9606.ENSP00000368253	0.768	Nuclear receptor subfamily 0 group B member 1
10	9606.ENSP00000394888	0.766	Dedicator of cytokinesis protein 8
11	9606.ENSP00000359567	0.765	Transcription factor SOX-3
12	9606.ENSP00000440440	0.720	Activating transcription factor 7-interacting protein 1
13	9606.ENSP00000275764	0.681	Stimulated by retinoic acid gene 8 protein homolog
14	9606.ENSP00000348944	0.656	R-spondin-1
15	9606.ENSP00000341992	0.654	Nanos homolog 3
16	9606.ENSP00000331327	0.650	Wilms tumor protein
17	9606.ENSP00000348132	0.648	Serine/threonine kinase 31
18	9606.ENSP00000341021	0.637	Nanos homolog 2
19	9606.ENSP00000341765	0.637	Spermatogenesis-associated protein 16
20	9606.ENSP00000369210	0.637	Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.599	transcription regulator activity
GO:0003700	0.380	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0046661	0.988	male sex differentiation
GO:0009987	0.974	cellular process
GO:0007530	0.723	sex determination
GO:0048731	0.704	system development
GO:0048518	0.595	positive regulation of biological process
GO:0019222	0.571	regulation of metabolic process
GO:0031323	0.541	regulation of cellular metabolic process
GO:0060255	0.529	regulation of macromolecule metabolic process
GO:0080090	0.528	regulation of primary metabolic process
GO:0051171	0.520	regulation of nitrogen compound metabolic process
GO:0048522	0.513	positive regulation of cellular process
GO:0019219	0.509	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.502	regulation of gene expression
GO:0031326	0.502	regulation of cellular biosynthetic process
GO:0010556	0.495	regulation of macromolecule biosynthetic process
GO:0051252	0.456	regulation of RNA metabolic process
GO:0048513	0.434	animal organ development
GO:0006355	0.417	regulation of DNA-templated transcription
GO:0050896	0.372	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.795	cytoplasm
GO:0070013	0.719	intracellular organelle lumen
GO:0031981	0.664	nuclear lumen
GO:0005654	0.585	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]