StarFunc result for job id Q9Y5S1

User Input

>input (764 residues)
MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNY
RKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCL
MKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVK
LLVENGANVHARACGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQA
TDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKL
AAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCEENSVLEIIAF
HCKSPHRHRMVVLEPLNKLLQAKWDLLIPKFFLNFLCNLIYMFIFTAVAYHQPTLKKQAA
PHLKAEVGNSMLLTGHILILLGGIYLLVGQLWYFWRRHVFIWISFIDSYFEILFLFQALL
TVVSQVLCFLAIEWYLPLLVSALVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLL
IYLVFLFGFAVALVSLSQEAWRPEAPTGPNATESVQPMEGQEDEGNGAQYRGILEASLEL
FKFTIGMGELAFQEQLHFRGMVLLLLLAYVLLTYILLLNMLIALMSETVNSVATDSWSIW
KLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDERWCFRVEEVNWASWEQTLPT
LCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5S1	1.000	1.000	0.000	764	1.000	1.000	Q9Y5S1.pdb.gz	TRPV2_HUMAN Transient receptor potential cation channel subfamily V member 2 OS=Homo sapiens OX=9606 GN=TRPV2 PE=1 SV=1
2	AFDB:G1SNM3	0.944	0.883	4.785E-91	817	0.836	0.782	G1SNM3.pdb.gz	G1SNM3_RABIT Transient receptor potential cation channel subfamily V member 2 OS=Oryctolagus cuniculus OX=9986 GN=TRPV2 PE=1 SV=2
3	AFDB:Q5EA32	0.903	0.916	9.078E-85	753	0.767	0.778	Q5EA32.pdb.gz	Q5EA32_BOVIN Transient receptor potential cation channel subfamily V member 2 OS=Bos taurus OX=9913 GN=TRPV2 PE=1 SV=1
4	AFDB:Q9WUD2	0.915	0.919	1.016E-82	761	0.774	0.777	Q9WUD2.pdb.gz	TRPV2_RAT Transient receptor potential cation channel subfamily V member 2 OS=Rattus norvegicus OX=10116 GN=Trpv2 PE=1 SV=2
5	PDB:6u84A	0.789	0.953	1.405E-68	630	0.695	0.843	6u84A.pdb.gz
6	PDB:6bwjB	0.777	0.957	1.656E-67	617	0.713	0.883	6bwjB.pdb.gz	Conformational plasticity in the selectivity filter of the TRPV2 ion channel.
7	AFDB:Q704Y3	0.788	0.722	2.723E-56	839	0.454	0.414	Q704Y3.pdb.gz	TRPV1_MOUSE Transient receptor potential cation channel subfamily V member 1 OS=Mus musculus OX=10090 GN=Trpv1 PE=1 SV=1
8	AFDB:Q8NER1	0.796	0.728	4.019E-56	839	0.457	0.416	Q8NER1.pdb.gz	TRPV1_HUMAN Transient receptor potential cation channel subfamily V member 1 OS=Homo sapiens OX=9606 GN=TRPV1 PE=1 SV=2
9	AFDB:A0A1J0M1I2	0.851	0.795	4.197E-56	819	0.432	0.403	A0A1J0M1I2.pdb.gz
10	AFDB:A2BG42	0.788	0.706	7.178E-53	856	0.424	0.379	A2BG42.pdb.gz
11	AFDB:B2KN54	0.813	0.716	1.564E-52	871	0.427	0.374	B2KN54.pdb.gz	B2KN54_CANLF TRPV4 OS=Canis lupus familiaris OX=9615 GN=LOC100856786 PE=2 SV=1
12	AFDB:A0A6I8RQZ3	0.806	0.713	9.145E-51	868	0.420	0.370	A0A6I8RQZ3.pdb.gz	A0A6I8RQZ3_XENTR Transient receptor potential cation channel subfamily V member 4 OS=Xenopus tropicalis OX=8364 GN=trpv4 PE=1 SV=1
13	PDB:7lp9A	0.772	0.923	2.164E-48	634	0.433	0.522	7lp9A.pdb.gz	Heat-dependent opening of TRPV1 in the presence of capsaicin.
14	PDB:7aa5A	0.690	0.848	4.323E-38	612	0.393	0.490	7aa5A.pdb.gz
15	PDB:6mhvA	0.698	0.859	1.452E-37	613	0.340	0.424	6mhvA.pdb.gz
16	PDB:6pvpA	0.712	0.814	1.027E-32	661	0.338	0.390	6pvpA.pdb.gz
17	PDB:6uw9A	0.651	0.840	3.165E-32	582	0.334	0.438	6uw9A.pdb.gz
18	PDB:6pvqA	0.524	0.697	8.786E-25	562	0.241	0.327	6pvqA.pdb.gz
19	PDB:6e2fC	0.654	0.765	4.962E-24	647	0.228	0.269	6e2fC.pdb.gz	Mechanism of calmodulin inactivation of the calcium-selective TRP channel TRPV6.
20	PDB:6dmwA	0.638	0.761	5.364E-23	631	0.226	0.274	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6I8RQZ3	0.0	570	868	0.415	0.365	A0A6I8RQZ3_XENTR Transient receptor potential cation channel subfamily V member 4 OS=Xenopus tropicalis OX=8364 GN=trpv4 PE=1 SV=1
2	B0S711	0.0	602	813	0.446	0.419	B0S711_DANRE Transient receptor potential cation channel subfamily V member 1 OS=Danio rerio OX=7955 GN=si:dkey-9e15.2 PE=4 SV=1
3	B2KN54	0.0	570	871	0.420	0.369	B2KN54_CANLF TRPV4 OS=Canis lupus familiaris OX=9615 GN=LOC100856786 PE=2 SV=1
4	B3VP30	0.0	568	871	0.407	0.357	B3VP30_PIG Transient receptor potential cation channel subfamily V member 4 OS=Sus scrofa OX=9823 GN=TRPV4 PE=2 SV=1
5	B6RTA2	0.0	598	819	0.442	0.413	B6RTA2_DANRE Transient receptor potential cation channel subfamily V member 1 OS=Danio rerio OX=7955 GN=TRPV1 PE=2 SV=1
6	G1SNM3	0.0	1201	817	0.838	0.783	G1SNM3_RABIT Transient receptor potential cation channel subfamily V member 2 OS=Oryctolagus cuniculus OX=9986 GN=TRPV2 PE=1 SV=2
7	O35433	0.0	652	838	0.449	0.409	TRPV1_RAT Transient receptor potential cation channel subfamily V member 1 OS=Rattus norvegicus OX=10116 GN=Trpv1 PE=1 SV=1
8	Q0PEH1	0.0	553	841	0.403	0.366	Q0PEH1_DANRE Transient receptor potential cation channel subfamily V member 4 OS=Danio rerio OX=7955 GN=wu:fp52e02 PE=2 SV=1
9	Q5EA32	0.0	1107	753	0.768	0.780	Q5EA32_BOVIN Transient receptor potential cation channel subfamily V member 2 OS=Bos taurus OX=9913 GN=TRPV2 PE=1 SV=1
10	Q704Y3	0.0	649	839	0.448	0.408	TRPV1_MOUSE Transient receptor potential cation channel subfamily V member 1 OS=Mus musculus OX=10090 GN=Trpv1 PE=1 SV=1
11	Q8NER1	0.0	651	839	0.441	0.402	TRPV1_HUMAN Transient receptor potential cation channel subfamily V member 1 OS=Homo sapiens OX=9606 GN=TRPV1 PE=1 SV=2
12	Q9EPK8	0.0	565	871	0.402	0.352	TRPV4_MOUSE Transient receptor potential cation channel subfamily V member 4 OS=Mus musculus OX=10090 GN=Trpv4 PE=1 SV=1
13	Q9ERZ8	0.0	569	871	0.406	0.356	TRPV4_RAT Transient receptor potential cation channel subfamily V member 4 OS=Rattus norvegicus OX=10116 GN=Trpv4 PE=1 SV=1
14	Q9HBA0	0.0	568	871	0.406	0.356	TRPV4_HUMAN Transient receptor potential cation channel subfamily V member 4 OS=Homo sapiens OX=9606 GN=TRPV4 PE=1 SV=2
15	Q9WTR1	0.0	1142	756	0.805	0.813	TRPV2_MOUSE Transient receptor potential cation channel subfamily V member 2 OS=Mus musculus OX=10090 GN=Trpv2 PE=1 SV=2
16	Q9WUD2	0.0	1092	761	0.777	0.781	TRPV2_RAT Transient receptor potential cation channel subfamily V member 2 OS=Rattus norvegicus OX=10116 GN=Trpv2 PE=1 SV=2
17	Q9Y5S1	0.0	1577	764	1.000	1.000	TRPV2_HUMAN Transient receptor potential cation channel subfamily V member 2 OS=Homo sapiens OX=9606 GN=TRPV2 PE=1 SV=1
18	F1RIT1	1.45e-159	485	823	0.366	0.340	F1RIT1_PIG Transient receptor potential cation channel subfamily V member 4 OS=Sus scrofa OX=9823 GN=TRPV4 PE=4 SV=4
19	Q9Z182	1.88e-143	433	528	0.304	0.439	Q9Z182_RAT Stretch-inhibitable nonselective channel (SIC) OS=Rattus norvegicus OX=10116 PE=2 SV=2
20	E9PU00	3.11e-137	426	791	0.349	0.338	E9PU00_RAT Transient receptor potential cation channel, subfamily V, member 3 OS=Rattus norvegicus OX=10116 GN=Trpv3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.3e-08	46.1	Ankyrin repeat
2	PF12796 Ank_2	9.3e-12	56.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.00019	32.5	Ankyrin repeat
4	PF13637 Ank_4	0.00016	33.4	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.7e-07	41.5	Ankyrin repeats (many copies)
6	PF00520 Ion_trans	5.1e-16	70.2	Ion transport protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342222

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320239	0.954	Transient receptor potential cation channel subfamily M member 7
2	9606.ENSP00000381023	0.935	Transient receptor potential cation channel subfamily M member 2
3	9606.ENSP00000323926	0.898	Transient receptor potential cation channel subfamily M member 8
4	9606.ENSP00000262209	0.892	Transient receptor potential cation channel subfamily A member 1
5	9606.ENSP00000302665	0.849	Insulin-like growth factor I
6	9606.ENSP00000252826	0.820	Transient receptor potential cation channel subfamily M member 4
7	9606.ENSP00000340913	0.819	Short transient receptor potential channel 6
8	9606.ENSP00000419313	0.814	Short transient receptor potential channel 1
9	9606.ENSP00000155858	0.800	Transient receptor potential cation channel subfamily M member 5
10	9606.ENSP00000368966	0.775	Short transient receptor potential channel 3
11	9606.ENSP00000358513	0.768	Cannabinoid receptor 1
12	9606.ENSP00000331746	0.767	Calcitonin
13	9606.ENSP00000366314	0.754	Transient receptor potential cation channel subfamily M member 3
14	9606.ENSP00000369027	0.741	Short transient receptor potential channel 4
15	9606.ENSP00000262839	0.736	Short transient receptor potential channel 5
16	9606.ENSP00000355777	0.712	Golgi resident protein GCP60
17	9606.ENSP00000357674	0.704	SNARE-associated protein Snapin
18	9606.ENSP00000405338	0.677	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
19	9606.ENSP00000437849	0.670	Transient receptor potential cation channel subfamily M member 1
20	9606.ENSP00000233840	0.669	Sialidase-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005262	1.000	calcium channel activity
GO:0042802	0.796	identical protein binding
GO:0022839	0.719	monoatomic ion gated channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050896	0.978	response to stimulus
GO:0051179	0.976	localization
GO:0006810	0.972	transport
GO:0065007	0.961	biological regulation
GO:0050789	0.947	regulation of biological process
GO:0032501	0.943	multicellular organismal process
GO:0006816	0.943	calcium ion transport
GO:0070588	0.886	calcium ion transmembrane transport
GO:0009628	0.863	response to abiotic stimulus
GO:0050794	0.862	regulation of cellular process
GO:0003008	0.784	system process
GO:0009266	0.595	response to temperature stimulus
GO:0007600	0.574	sensory perception
GO:0048518	0.468	positive regulation of biological process
GO:0048522	0.428	positive regulation of cellular process
GO:0051716	0.368	cellular response to stimulus
GO:0006950	0.333	response to stress
GO:0065008	0.310	regulation of biological quality
GO:0071840	0.308	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.665	intracellular anatomical structure
GO:0005737	0.607	cytoplasm
GO:0043227	0.555	membrane-bounded organelle
GO:0043229	0.500	intracellular organelle
GO:0120025	0.475	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]