StarFunc result for job id Q9Y5S2

User Input

>input (1711 residues)
MSAKVRLKKLEQLLLDGPWRNESALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAK
PFTQLVKEMQLHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETAC
FREERDVLVNGDCQWITALHYAFQDENHLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFY
IGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTP
DYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERF
QFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEGLNWENIRNLEAPYIPD
VSSPSDTSNFDVDDDVLRNTEILPPGSHTGFSGLHLPFIGFTFTTESCFSDRGSLKSIMQ
SNTLTKDEDVQRDLEHSLQMEAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSSRALSN
SNRDKEIKKLNEEIERLKNKIADSNRLERQLEDTVALRQEREDSTQRLRGLEKQHRVVRQ
EKEELHKQLVEASERLKSQAKELKDAHQQRKLALQEFSELNERMAELRAQKQKVSRQLRD
KEEEMEVATQKVDAMRQEMRRAEKLRKELEAQLDDAVAEASKERKLREHSENFCKQMESE
LEALKVKQGGRGAGATLEHQQEISKIKSELEKKVLFYEEELVRREASHVLEVKNVKKEVH
DSESHQLALQKEILMLKDKLEKSKRERHNEMEEAVGTIKDKYERERAMLFDENKKLTAEN
EKLCSFVDKLTAQNRQLEDELQDLAAKKESVAHWEAQIAEIIQWVSDEKDARGYLQALAS
KMTEELEALRSSSLGSRTLDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLVQEELRKV
KDANLTLESKLKDSEAKNRELLEEMEILKKKMEEKFRADTGLKLPDFQDSIFEYFNTAPL
AHDLTFRTSSASEQETQAPKPEASPSMSVAASEQQEDMARPPQRPSAVPLPTTQALALAG
PKPKAHQFSIKSFSSPTQCSHCTSLMVGLIRQGYACEVCSFACHVSCKDGAPQVCPIPPE
QSKRPLGVDVQRGIGTAYKGHVKVPKPTGVKKGWQRAYAVVCDCKLFLYDLPEGKSTQPG
VIASQVLDLRDDEFSVSSVLASDVIHATRRDIPCIFRVTASLLGAPSKTSSLLILTENEN
EKRKWVGILEGLQSILHKNRLRNQVVHVPLEAYDSSLPLIKAILTAAIVDADRIAVGLEE
GLYVIEVTRDVIVRAADCKKVHQIELAPREKIVILLCGRNHHVHLYPWSSLDGAEGSFDI
KLPETKGCQLMATATLKRNSGTCLFVAVKRLILCYEIQRTKPFHRKFNEIVAPGSVQCLA
VLRDRLCVGYPSGFCLLSIQGDGQPLNLVNPNDPSLAFLSQQSFDALCAVELESEEYLLC
FSHMGLYVDPQGRRARAQELMWPAAPVACSCSPTHVTVYSEYGVDVFDVRTMEWVQTIGL
RRIRPLNSEGTLNLLNCEPPRLIYFKSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKV
PEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERP
GPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTPS
NSSNPSGPPSPNSPHRSQLPLEGLEQPACDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O01583	0.457	0.487	0.000	1592	0.361	0.388	O01583.pdb.gz	MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans OX=6239 GN=mrck-1 PE=1 SV=3
2	AFDB:O54874	0.334	0.330	0.000	1732	0.616	0.609	O54874.pdb.gz	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
3	AFDB:Q6DT37	0.321	0.352	0.000	1551	0.411	0.453	Q6DT37.pdb.gz	MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2
4	AFDB:Q7TT49	0.520	0.520	0.000	1713	0.921	0.920	Q7TT49.pdb.gz	MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1
5	AFDB:Q9W1B0	0.299	0.312	0.000	1637	0.413	0.432	Q9W1B0.pdb.gz	GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster OX=7227 GN=gek PE=1 SV=1
6	AFDB:O14578	0.253	0.219	4.504E-79	2027	0.252	0.213	O14578.pdb.gz	CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT PE=1 SV=2
7	AFDB:E9PSL7	0.226	0.189	1.958E-77	2055	0.250	0.208	E9PSL7.pdb.gz	CTRO_RAT Citron rho-interacting kinase OS=Rattus norvegicus OX=10116 GN=Cit PE=1 SV=1
8	AFDB:A0A0R4IVY5	0.229	0.286	5.795E-50	1359	0.205	0.258	A0A0R4IVY5.pdb.gz	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2
9	AFDB:A0A0R4IHT4	0.226	0.276	7.477E-50	1396	0.203	0.249	A0A0R4IHT4.pdb.gz
10	AFDB:M3TYT0	0.223	0.274	1.438E-48	1388	0.200	0.246	M3TYT0.pdb.gz	ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa OX=9823 GN=ROCK2 PE=1 SV=1
11	PDB:6byrA	0.170	0.688	8.997E-26	405	0.077	0.326	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:5x3fB	0.155	0.713	8.399E-24	349	0.065	0.318	5x3fB.pdb.gz
13	PDB:4yhjA	0.170	0.548	8.838E-24	501	0.058	0.200	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
14	PDB:3pfqA	0.173	0.539	3.004E-23	523	0.067	0.220	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
15	PDB:3pvuA	0.169	0.448	3.004E-23	609	0.066	0.186	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
16	PDB:3c4wB	0.163	0.513	5.537E-23	519	0.061	0.200	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:6pjxA	0.177	0.526	7.518E-23	543	0.061	0.192	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
18	PDB:4mk0A	0.176	0.448	1.699E-22	631	0.064	0.174	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:3nynA	0.178	0.521	1.788E-22	554	0.061	0.188	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
20	PDB:5dykA	0.160	0.331	3.469E-22	809	0.060	0.126	5dykA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O01583	0.0	1040	1592	0.369	0.397	MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans OX=6239 GN=mrck-1 PE=1 SV=3
2	O54874	0.0	2141	1732	0.608	0.601	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
3	Q3UU96	0.0	2145	1719	0.612	0.609	MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus OX=10090 GN=Cdc42bpa PE=1 SV=2
4	Q5VT25	0.0	2138	1732	0.611	0.604	MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens OX=9606 GN=CDC42BPA PE=1 SV=1
5	Q6DT37	0.0	1240	1551	0.406	0.448	MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2
6	Q7TT49	0.0	3247	1713	0.922	0.921	MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1
7	Q7TT50	0.0	3245	1713	0.920	0.919	MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus OX=10090 GN=Cdc42bpb PE=1 SV=2
8	Q86XZ8	0.0	1034	492	0.286	0.994	Q86XZ8_HUMAN CDC42BPB protein (Fragment) OS=Homo sapiens OX=9606 GN=CDC42BPB PE=2 SV=1
9	Q9W1B0	0.0	1204	1637	0.398	0.416	GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster OX=7227 GN=gek PE=1 SV=1
10	Q9Y5S2	0.0	3542	1711	1.000	1.000	MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2
11	Q09013	1.21e-157	497	629	0.143	0.390	DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens OX=9606 GN=DMPK PE=1 SV=3
12	A0A8I6ANX6	2.62e-157	497	651	0.158	0.416	A0A8I6ANX6_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Dmpk PE=3 SV=1
13	P54265	6.75e-153	484	631	0.140	0.379	DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus OX=10090 GN=Dmpk PE=1 SV=1
14	D3ZYV4	9.62e-140	448	605	0.153	0.433	D3ZYV4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Dmpk PE=3 SV=4
15	A0A0R4IVY5	2.01e-135	458	1359	0.221	0.278	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2
16	P70335	4.34e-131	446	1354	0.186	0.235	ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Rock1 PE=1 SV=1
17	F1MF50	1.45e-130	444	1356	0.188	0.237	F1MF50_BOVIN Rho-associated protein kinase OS=Bos taurus OX=9913 GN=ROCK1 PE=3 SV=3
18	Q13464	1.75e-130	444	1354	0.189	0.239	ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1
19	A0A8C0NIR0	4.55e-130	443	1355	0.188	0.238	A0A8C0NIR0_CANLF Rho-associated protein kinase OS=Canis lupus familiaris OX=9615 GN=ROCK1 PE=1 SV=1
20	Q63644	5.64e-130	443	1369	0.185	0.231	ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Rock1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	1.2e-07	42.8	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	2.1e+02	13.7	C1 domain
3	PF00780 CNH	4e-62	221.9	CNH domain
4	PF08826 DMPK_coil	6.1e-22	88.8	DMPK coiled coil domain like
5	PF15796 KELK	2.7e-27	106.3	KELK-motif containing domain of MRCK Ser/Thr protein kinase
6	PF14531 Kinase-like	0.041	24.8	Kinase-like
7	PF00786 PBD	3.4	19.5	P21-Rho-binding domain
8	PF00169 PH	22	17.0	PH domain
9	PF00069 Pkinase	6.6e-53	191.3	Protein kinase domain
10	PF07714 PK_Tyr_Ser-Thr	3.3e-27	107.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355237

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382507	0.801	UBX domain-containing protein 2B
2	9606.ENSP00000383118	0.769	Cell division control protein 42 homolog
3	9606.ENSP00000223167	0.698	Myosin regulatory light chain 10
4	9606.ENSP00000296328	0.644	UBX domain-containing protein 7
5	9606.ENSP00000454207	0.615	TNF receptor-associated factor 3
6	9606.ENSP00000383023	0.608	Myosin light chain 5
7	9606.ENSP00000299155	0.607	Protein amnionless
8	9606.ENSP00000393776	0.553	F-BAR domain only protein 2
9	9606.ENSP00000220062	0.548	Ras-like protein family member 12
10	9606.ENSP00000437073	0.541	Unconventional myosin-XVIIIa
11	9606.ENSP00000457991	0.518	PH domain leucine-rich repeat-containing protein phosphatase 2
12	9606.ENSP00000385749	0.514	cAMP-dependent protein kinase type I-beta regulatory subunit
13	9606.ENSP00000363135	0.504	Uncharacterized protein C6orf106
14	9606.ENSP00000416015	0.504	[F-actin]-monooxygenase MICAL3
15	9606.ENSP00000481917	0.502	Seizure 6-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0004674	0.997	protein serine/threonine kinase activity
GO:0019899	0.870	enzyme binding
GO:0031267	0.845	small GTPase binding
GO:0043168	0.473	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.990	biological regulation
GO:0007010	0.990	cytoskeleton organization
GO:0043170	0.989	macromolecule metabolic process
GO:0050789	0.983	regulation of biological process
GO:0016310	0.979	phosphorylation
GO:0050794	0.971	regulation of cellular process
GO:0006468	0.968	protein phosphorylation
GO:0031032	0.955	actomyosin structure organization
GO:0048870	0.728	cell motility
GO:0050896	0.592	response to stimulus
GO:0016477	0.492	cell migration
GO:0051716	0.438	cellular response to stimulus
GO:0007154	0.415	cell communication
GO:0023052	0.314	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.997	cytoskeleton
GO:0043227	0.996	membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0042641	0.970	actomyosin
GO:0005576	0.876	extracellular region
GO:0031982	0.860	vesicle
GO:0043231	0.707	intracellular membrane-bounded organelle
GO:0016020	0.534	membrane
GO:1903561	0.437	extracellular vesicle
GO:0070062	0.420	extracellular exosome
GO:0030054	0.340	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.997	Phosphotransferases with an alcohol group as acceptor.

[back to server]