StarFunc result for job id Q9Y5T5

User Input

>input (823 residues)
MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
AEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCD
NEVQYCSSNQLGQVVDYVRKQASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENM
AKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPD
LALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKELFSQVCKKAVRFKGYQQQDS
QELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSMPSFVDRIFG
GELTSMIMCDQCRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTVEDEDQDSEEEKD
NDSYIKERSDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDSE
YEAEMSLQGEVNIKSNHISQEGVMHKEYCVNQKDLNGQAKMIESVTDNQKSTEEVDMKNI
NMDNDLEVLTSSPTRNLNGAYLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHT
PGTKVYEVVNEDPETAFCTLANREVFNTDECSIQHCLYQFTRNEKLRDANKLLCEVCTRR
QCNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPEIL
DLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARTANSHLSNLVLHGD
IPQDFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99LG0	0.541	0.540	0.000	825	0.832	0.830	Q99LG0.pdb.gz	UBP16_MOUSE Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus OX=10090 GN=Usp16 PE=1 SV=2
2	AFDB:Q9Y5T5	1.000	1.000	0.000	823	1.000	1.000	Q9Y5T5.pdb.gz	UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens OX=9606 GN=USP16 PE=1 SV=1
3	AFDB:Q6PAW2	0.536	0.492	6.345E-90	901	0.553	0.505	Q6PAW2.pdb.gz	UBP16_XENLA Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus laevis OX=8355 GN=usp16 PE=2 SV=1
4	PDB:3mhsA	0.391	0.659	7.421E-23	455	0.143	0.259	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
5	PDB:5cvnB	0.325	0.800	8.532E-20	321	0.124	0.318	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
6	PDB:4fjcE	0.299	0.540	1.258E-19	434	0.139	0.263	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
7	PDB:5k16B	0.316	0.743	9.805E-19	328	0.132	0.332	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
8	PDB:4wa6D	0.353	0.647	3.059E-17	415	0.135	0.267	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
9	PDB:7ay1D	0.313	0.726	4.268E-17	341	0.126	0.305	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
10	PDB:3ihpB	0.306	0.367	9.281E-17	681	0.123	0.148	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
11	AFDB:Q9SB51	0.322	0.265	5.802E-16	1008	0.163	0.133	Q9SB51.pdb.gz	UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1
12	AFDB:Q70EL4	0.341	0.253	1.129E-15	1123	0.158	0.116	Q70EL4.pdb.gz	UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens OX=9606 GN=USP43 PE=1 SV=2
13	PDB:8a9kD	0.275	0.755	1.858E-15	285	0.108	0.312	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
14	PDB:7yxxA	0.307	0.149	4.514E-15	1754	0.101	0.047	7yxxA.pdb.gz
15	PDB:5gjqx	0.302	0.661	3.063E-13	355	0.109	0.254	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
16	AFDB:Q14694	0.315	0.324	2.986E-10	798	0.136	0.140	Q14694.pdb.gz	UBP10_HUMAN Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2
17	AFDB:P15975	0.167	0.131	5.507E-4	1069	0.091	0.070	P15975.pdb.gz	UBP53_MOUSE Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Mus musculus OX=10090 GN=Usp53 PE=1 SV=2
18	AFDB:Q70EK8	0.172	0.134	1.974E-3	1073	0.103	0.079	Q70EK8.pdb.gz	UBP53_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Homo sapiens OX=9606 GN=USP53 PE=1 SV=2
19	AFDB:P52168	0.046	0.067	5.511E-2	540	0.040	0.061	P52168.pdb.gz	PNR_DROME GATA-binding factor A OS=Drosophila melanogaster OX=7227 GN=pnr PE=1 SV=1
20	AFDB:Q07292	0.061	0.061	1.582E-1	813	0.067	0.068	Q07292.pdb.gz	KRAF1_CAEEL Raf homolog serine/threonine-protein kinase OS=Caenorhabditis elegans OX=6239 GN=lin-45 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99LG0	0.0	1354	825	0.826	0.824	UBP16_MOUSE Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus OX=10090 GN=Usp16 PE=1 SV=2
2	Q9Y5T5	0.0	1709	823	1.000	1.000	UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens OX=9606 GN=USP16 PE=1 SV=1
3	Q6PAW2	1.08e-167	510	901	0.349	0.319	UBP16_XENLA Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus laevis OX=8355 GN=usp16 PE=2 SV=1
4	Q70EL2	4.37e-102	336	814	0.210	0.213	UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 OS=Homo sapiens OX=9606 GN=USP45 PE=1 SV=3
5	Q8K387	7.71e-97	322	813	0.225	0.228	UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 OS=Mus musculus OX=10090 GN=Usp45 PE=1 SV=1
6	E9QG68	8.00e-95	316	803	0.216	0.222	UBP45_DANRE Ubiquitin carboxyl-terminal hydrolase 45 OS=Danio rerio OX=7955 GN=usp45 PE=2 SV=1
7	Q8W4N3	9.49e-28	122	961	0.122	0.104	UBP2_ARATH Ubiquitin carboxyl-terminal hydrolase 2 OS=Arabidopsis thaliana OX=3702 GN=UBP2 PE=1 SV=2
8	E7EZD6	1.19e-22	106	1009	0.086	0.070	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
9	F4I642	1.29e-20	100	928	0.079	0.070	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1
10	Q9FPS9	1.33e-20	100	924	0.079	0.070	UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=2
11	Q9R085	1.47e-20	99.8	952	0.078	0.067	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
12	Q9Y4E8	1.53e-20	99.8	981	0.078	0.065	UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3
13	Q8R5H1	1.76e-20	99.8	981	0.078	0.065	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
14	A0A8I6A351	1.91e-20	98.2	506	0.117	0.190	A0A8I6A351_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
15	Q6JHV3	2.46e-20	97.8	498	0.125	0.207	Q6JHV3_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
16	H0YMI4	3.46e-20	97.1	503	0.125	0.205	H0YMI4_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
17	A1L1I5	4.01e-20	96.3	423	0.117	0.227	A1L1I5_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
18	Q9Y6I4	4.37e-20	97.1	520	0.125	0.198	UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=2
19	O88623	8.03e-20	96.7	619	0.085	0.113	UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus OX=10090 GN=Usp2 PE=1 SV=3
20	Q4JL29	1.37e-19	95.5	520	0.120	0.190	Q4JL29_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05173 DapB_C	2.3e+02	13.2	Dihydrodipicolinate reductase, C-terminus
2	PF00443 UCH	1.5e-54	197.0	Ubiquitin carboxyl-terminal hydrolase
3	PF02148 zf-UBP	4.7e-17	73.4	Zn-finger in ubiquitin-hydrolases and other protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334808

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441543	0.984	Polyubiquitin-C
2	9606.ENSP00000356981	0.932	Ubiquitin carboxyl-terminal hydrolase 21
3	9606.ENSP00000388107	0.907	Ubiquitin-60S ribosomal protein L40
4	9606.ENSP00000272317	0.906	Ubiquitin-40S ribosomal protein S27a
5	9606.ENSP00000304697	0.906	Polyubiquitin-B
6	9606.ENSP00000332194	0.883	Histone H2A type 2-C
7	9606.ENSP00000344446	0.729	FYVE, RhoGEF and PH domain-containing protein 6
8	9606.ENSP00000261609	0.724	E3 ubiquitin-protein ligase HERC2
9	9606.ENSP00000418734	0.718	Histone H2A deubiquitinase MYSM1
10	9606.ENSP00000378699	0.711	Cyclin-dependent kinase 1
11	9606.ENSP00000338788	0.686	Zinc finger CCCH domain-containing protein 15
12	9606.ENSP00000441140	0.662	Nucleolar protein 8
13	9606.ENSP00000175506	0.657	Asparagine synthetase
14	9606.ENSP00000433146	0.653	Ubiquitin carboxyl-terminal hydrolase 47
15	9606.ENSP00000297012	0.652	Histone H2A type 1-A
16	9606.ENSP00000355656	0.652	Histone H2A type 3
17	9606.ENSP00000367022	0.652	Histone H2A type 1-C
18	9606.ENSP00000418693	0.644	RWD domain containing 2B
19	9606.ENSP00000261622	0.641	Large neutral amino acids transporter small subunit 1
20	9606.ENSP00000332790	0.635	Histone H2A type 2-B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0032182	0.770	ubiquitin-like protein binding
GO:0042393	0.762	histone binding
GO:0046914	0.730	transition metal ion binding
GO:0043130	0.722	ubiquitin binding
GO:0003713	0.706	transcription coactivator activity
GO:0004175	0.706	endopeptidase activity
GO:0004197	0.703	cysteine-type endopeptidase activity
GO:0008270	0.700	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043412	0.995	macromolecule modification
GO:0006508	0.995	proteolysis
GO:0050794	0.991	regulation of cellular process
GO:0016579	0.991	protein deubiquitination
GO:0019222	0.949	regulation of metabolic process
GO:0009987	0.936	cellular process
GO:0060255	0.924	regulation of macromolecule metabolic process
GO:0051171	0.919	regulation of nitrogen compound metabolic process
GO:0080090	0.917	regulation of primary metabolic process
GO:0031323	0.887	regulation of cellular metabolic process
GO:0048518	0.858	positive regulation of biological process
GO:0019219	0.853	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.841	positive regulation of metabolic process
GO:0048522	0.832	positive regulation of cellular process
GO:0010468	0.788	regulation of gene expression
GO:0010556	0.725	regulation of macromolecule biosynthetic process
GO:0031326	0.725	regulation of cellular biosynthetic process
GO:0010604	0.714	positive regulation of macromolecule metabolic process
GO:0051173	0.691	positive regulation of nitrogen compound metabolic process
GO:0031325	0.548	positive regulation of cellular metabolic process
GO:0050896	0.528	response to stimulus
GO:0016570	0.504	histone modification
GO:0044237	0.439	cellular metabolic process
GO:0051252	0.416	regulation of RNA metabolic process
GO:0051716	0.412	cellular response to stimulus
GO:0071840	0.377	cellular component organization or biogenesis
GO:0051246	0.358	regulation of protein metabolic process
GO:2001141	0.356	regulation of RNA biosynthetic process
GO:0006355	0.349	regulation of DNA-templated transcription
GO:0016578	0.330	histone deubiquitination
GO:0033554	0.317	cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0005829	0.941	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.703	Cysteine endopeptidases.

[back to server]