StarFunc result for job id Q9Y5U5

User Input

>input (241 residues)
MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRD
YPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTF
SGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLL
TSAQLGLHIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLW
V

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5U5	1.000	1.000	1.397E-42	241	1.000	1.000	Q9Y5U5.pdb.gz	TNR18_HUMAN Tumor necrosis factor receptor superfamily member 18 OS=Homo sapiens OX=9606 GN=TNFRSF18 PE=1 SV=1
2	AFDB:O35714	0.530	0.558	5.763E-26	228	0.552	0.583	O35714.pdb.gz	TNR18_MOUSE Tumor necrosis factor receptor superfamily member 18 OS=Mus musculus OX=10090 GN=Tnfrsf18 PE=1 SV=1
3	AFDB:F1RII3	0.298	0.293	1.588E-9	246	0.274	0.268	F1RII3.pdb.gz	F1RII3_PIG TNF receptor superfamily member 9 OS=Sus scrofa OX=9823 GN=TNFRSF9 PE=4 SV=3
4	AFDB:Q4QQW2	0.249	0.211	4.753E-9	289	0.228	0.190	Q4QQW2.pdb.gz
5	AFDB:P20334	0.233	0.221	1.423E-8	256	0.261	0.246	P20334.pdb.gz	TNR9_MOUSE Tumor necrosis factor receptor superfamily member 9 OS=Mus musculus OX=10090 GN=Tnfrsf9 PE=1 SV=1
6	AFDB:Q07011	0.227	0.216	1.597E-8	255	0.261	0.247	Q07011.pdb.gz	TNR9_HUMAN Tumor necrosis factor receptor superfamily member 9 OS=Homo sapiens OX=9606 GN=TNFRSF9 PE=1 SV=1
7	AFDB:P27512	0.251	0.212	3.795E-8	289	0.241	0.201	P27512.pdb.gz	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
8	AFDB:Q9Y6Q6	0.271	0.128	7.159E-8	616	0.237	0.093	Q9Y6Q6.pdb.gz	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
9	AFDB:P25942	0.256	0.225	8.512E-8	277	0.187	0.162	P25942.pdb.gz	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
10	AFDB:P36941	0.258	0.152	1.701E-7	435	0.220	0.122	P36941.pdb.gz	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
11	PDB:7q3nU	0.086	0.074	5.110E-1	292	0.087	0.072	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:8a7dQ	0.077	0.072	5.110E-1	273	0.100	0.088	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
13	PDB:6oemB	0.084	0.067	1.444	346	0.054	0.038	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
14	PDB:7wihA	0.089	0.035	1.444	741	0.058	0.019	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
15	PDB:3elzB	0.088	0.135	1.927	135	0.029	0.052	3elzB.pdb.gz	The X-Ray structure of zebrafish (Danio rerio) ileal bile acid-binding protein reveals the presence of binding sites on the surface of the protein molecule.
16	PDB:1xl6A	0.128	0.109	2.724	291	0.054	0.045	1xl6A.pdb.gz
17	PDB:5ltwL	0.102	0.213	3.431	100	0.050	0.120	5ltwL.pdb.gz
18	PDB:6fyxm	0.067	0.109	3.851	147	0.017	0.027	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
19	PDB:8a7eC	0.107	0.029	3.851	1524	0.124	0.020	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
20	PDB:5c5hB	0.121	0.087	4.080	448	0.054	0.029	5c5hB.pdb.gz	Mechanism of MenE Inhibition by Acyl-Adenylate Analogues and Discovery of Novel Antibacterial Agents.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y5U5	3.83e-176	485	241	1.000	1.000	TNR18_HUMAN Tumor necrosis factor receptor superfamily member 18 OS=Homo sapiens OX=9606 GN=TNFRSF18 PE=1 SV=1
2	O35714	1.90e-80	242	228	0.506	0.535	TNR18_MOUSE Tumor necrosis factor receptor superfamily member 18 OS=Mus musculus OX=10090 GN=Tnfrsf18 PE=1 SV=1
3	I2E6E0	7.30e-10	59.7	241	0.203	0.203	I2E6E0_PIG 4-1BB variant 2 OS=Sus scrofa OX=9823 PE=2 SV=1
4	F1RII3	8.77e-10	59.3	246	0.203	0.199	F1RII3_PIG TNF receptor superfamily member 9 OS=Sus scrofa OX=9823 GN=TNFRSF9 PE=4 SV=3
5	Q07011	5.80e-08	54.3	255	0.216	0.204	TNR9_HUMAN Tumor necrosis factor receptor superfamily member 9 OS=Homo sapiens OX=9606 GN=TNFRSF9 PE=1 SV=1
6	Q80WM9	1.88e-07	52.8	275	0.137	0.120	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
7	Q71F55	1.92e-07	52.8	276	0.137	0.120	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
8	P47741	2.30e-07	52.8	272	0.154	0.136	TNR4_MOUSE Tumor necrosis factor receptor superfamily member 4 OS=Mus musculus OX=10090 GN=Tnfrsf4 PE=1 SV=1
9	P43489	2.16e-06	49.7	277	0.100	0.087	TNR4_HUMAN Tumor necrosis factor receptor superfamily member 4 OS=Homo sapiens OX=9606 GN=TNFRSF4 PE=1 SV=1
10	O08712	6.58e-06	48.5	401	0.108	0.065	TR11B_MOUSE Tumor necrosis factor receptor superfamily member 11B OS=Mus musculus OX=10090 GN=Tnfrsf11b PE=1 SV=1
11	P15725	1.21e-05	47.4	271	0.137	0.122	TNR4_RAT Tumor necrosis factor receptor superfamily member 4 OS=Rattus norvegicus OX=10116 GN=Tnfrsf4 PE=2 SV=1
12	O08727	1.80e-05	47.4	401	0.104	0.062	TR11B_RAT Tumor necrosis factor receptor superfamily member 11B OS=Rattus norvegicus OX=10116 GN=Tnfrsf11b PE=2 SV=1
13	B8X730	2.02e-05	47.0	286	0.141	0.119	B8X730_DANRE CD40 molecule, TNF receptor superfamily member 5 OS=Danio rerio OX=7955 GN=si:ch211-231h20.3 PE=2 SV=1
14	Q9Y6Q6	3.13e-05	47.0	616	0.141	0.055	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
15	O00300	1.01e-04	45.1	401	0.108	0.065	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
16	O95407	1.02e-04	45.1	300	0.104	0.083	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
17	O35305	1.05e-04	45.4	625	0.133	0.051	TNR11_MOUSE Tumor necrosis factor receptor superfamily member 11A OS=Mus musculus OX=10090 GN=Tnfrsf11a PE=1 SV=1
18	O75509	1.36e-04	45.1	655	0.100	0.037	TNR21_HUMAN Tumor necrosis factor receptor superfamily member 21 OS=Homo sapiens OX=9606 GN=TNFRSF21 PE=1 SV=1
19	F6SVZ3	2.06e-04	43.9	269	0.158	0.141	F6SVZ3_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
20	P20334	2.38e-04	43.5	256	0.137	0.129	TNR9_MOUSE Tumor necrosis factor receptor superfamily member 9 OS=Mus musculus OX=10090 GN=Tnfrsf9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000017332

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000007909	0.994	Tumor necrosis factor (ligand) superfamily, member 18
2	60711.ENSCSAP00000009020	0.890	Forkhead box P3
3	60711.ENSCSAP00000006517	0.678	Cytotoxic T-lymphocyte-associated protein 4
4	60711.ENSCSAP00000006497	0.656	CD4 molecule
5	60711.ENSCSAP00000005956	0.641	Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl- x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis.
6	60711.ENSCSAP00000007491	0.604	Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia
7	60711.ENSCSAP00000006908	0.590	Tumor necrosis factor receptor superfamily, member 1A
8	60711.ENSCSAP00000004965	0.588	Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'- TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX
9	60711.ENSCSAP00000006504	0.569	Lymphocyte-activation gene 3
10	60711.ENSCSAP00000012425	0.559	CD8a molecule
11	60711.ENSCSAP00000009735	0.540	Interleukin 2 receptor, alpha
12	60711.ENSCSAP00000000035	0.530	Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response.
13	60711.ENSCSAP00000002443	0.529	Ectonucleoside triphosphate diphosphohydrolase 1
14	60711.ENSCSAP00000011058	0.529	Interleukin 10
15	60711.ENSCSAP00000006936	0.525	Hepatitis A virus cellular receptor 2
16	60711.ENSCSAP00000006836	0.524	CD27 molecule
17	60711.ENSCSAP00000013090	0.523	Interleukin 7 receptor
18	60711.ENSCSAP00000000682	0.522	Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons
19	60711.ENSCSAP00000005140	0.520	CD274 molecule
20	60711.ENSCSAP00000004092	0.516	MGA, MAX dimerization protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005035	1.000	death receptor activity
GO:0005031	0.920	tumor necrosis factor receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0030155	0.985	regulation of cell adhesion
GO:0048522	0.984	positive regulation of cellular process
GO:0009987	0.981	cellular process
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0051246	0.964	regulation of protein metabolic process
GO:0048519	0.947	negative regulation of biological process
GO:0002682	0.947	regulation of immune system process
GO:0051716	0.945	cellular response to stimulus
GO:0048523	0.942	negative regulation of cellular process
GO:0007165	0.941	signal transduction
GO:0045785	0.939	positive regulation of cell adhesion
GO:0001932	0.918	regulation of protein phosphorylation
GO:0010604	0.901	positive regulation of macromolecule metabolic process
GO:0051173	0.894	positive regulation of nitrogen compound metabolic process
GO:0050730	0.894	regulation of peptidyl-tyrosine phosphorylation
GO:0031325	0.893	positive regulation of cellular metabolic process
GO:0002684	0.889	positive regulation of immune system process
GO:0042981	0.877	regulation of apoptotic process
GO:0042509	0.825	regulation of tyrosine phosphorylation of STAT protein
GO:0001934	0.666	positive regulation of protein phosphorylation
GO:0050731	0.458	positive regulation of peptidyl-tyrosine phosphorylation
GO:0042531	0.443	positive regulation of tyrosine phosphorylation of STAT protein
GO:2000145	0.402	regulation of cell motility
GO:0048583	0.358	regulation of response to stimulus
GO:0002376	0.332	immune system process
GO:0030335	0.318	positive regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]