StarFunc result for job id Q9Y5W3

User Input

>input (355 residues)
MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEA
APEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRL
VKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDG
PARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAAR
GLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEK
PYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5W3	1.000	1.000	1.329E-56	355	1.000	1.000	Q9Y5W3.pdb.gz	KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens OX=9606 GN=KLF2 PE=1 SV=2
2	AFDB:Q60843	0.376	0.377	1.039E-46	354	0.876	0.879	Q60843.pdb.gz	KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus OX=10090 GN=Klf2 PE=1 SV=2
3	AFDB:A9CSE6	0.243	0.208	3.464E-11	416	0.259	0.221	A9CSE6.pdb.gz	A9CSE6_GLARU Wilms tumor 1 +KTS isoform OS=Glandirana rugosa OX=8410 GN=WT1 +KTS isoform PE=2 SV=1
4	AFDB:Q9I8A0	0.241	0.206	1.206E-10	417	0.259	0.221	Q9I8A0.pdb.gz	Q9I8A0_CHICK WT1(+KTS) protein OS=Gallus gallus OX=9031 GN=WT1(+KTS) PE=2 SV=1
5	AFDB:A0A0A0MT54	0.231	0.159	1.375E-10	522	0.296	0.201	A0A0A0MT54.pdb.gz	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
6	AFDB:R9PY21	0.232	0.115	4.197E-10	720	0.270	0.133	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
7	AFDB:Q9VEW6	0.210	0.082	1.194E-8	924	0.200	0.077	Q9VEW6.pdb.gz	Q9VEW6_DROME IP01015p OS=Drosophila melanogaster OX=7227 GN=pad PE=2 SV=2
8	AFDB:Q7KQN5	0.229	0.073	3.196E-8	1150	0.214	0.066	Q7KQN5.pdb.gz	Q7KQN5_DROME Datilografo, isoform A OS=Drosophila melanogaster OX=7227 GN=dati PE=2 SV=1
9	AFDB:B8A5T9	0.207	0.083	8.012E-8	927	0.290	0.111	B8A5T9.pdb.gz
10	AFDB:A2A935	0.210	0.060	1.269E-7	1275	0.248	0.069	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
11	PDB:3sbcB	0.074	0.119	4.859	197	0.020	0.036	3sbcB.pdb.gz
12	PDB:1de5A	0.053	0.047	8.215	417	0.025	0.022	1de5A.pdb.gz	The structure of rhamnose isomerase from Escherichia coli and its relation with xylose isomerase illustrates a change between inter and intra-subunit complementation during evolution.
13	PDB:6t9lN	0.075	0.239	8.215	82	0.023	0.098	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
14	PDB:3j6bW	0.095	0.177	8.772	112	0.034	0.107	3j6bW.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
15	PDB:6yxxAf	0.080	0.119	8.772	139	0.042	0.108	6yxxAf.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
16	PDB:7odrd	0.062	0.077	9.367	259	0.034	0.046	7odrd.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y5W3	0.0	686	355	1.000	1.000	KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens OX=9606 GN=KLF2 PE=1 SV=2
2	Q60843	2.73e-164	464	354	0.856	0.859	KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus OX=10090 GN=Klf2 PE=1 SV=2
3	Q9ET58	1.15e-163	463	351	0.848	0.858	KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus OX=10116 GN=Klf2 PE=1 SV=1
4	Q90XE7	5.06e-96	291	363	0.513	0.501	Q90XE7_DANRE Klf2b protein OS=Danio rerio OX=7955 GN=cb125 PE=2 SV=1
5	Q1LXI7	3.96e-89	274	380	0.496	0.463	Q1LXI7_DANRE Krueppel-like factor 2 OS=Danio rerio OX=7955 GN=etID35223.22 PE=4 SV=1
6	A9X6Q5	3.13e-69	224	396	0.482	0.432	A9X6Q5_DANRE Krueppel-like factor 4 OS=Danio rerio OX=7955 GN=klf4a PE=2 SV=1
7	O43474	3.36e-68	224	513	0.296	0.205	KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens OX=9606 GN=KLF4 PE=1 SV=3
8	Q9DFS2	8.01e-67	218	409	0.276	0.240	Q9DFS2_DANRE Biklf OS=Danio rerio OX=7955 GN=klf4 PE=2 SV=1
9	Q60793	9.00e-66	217	483	0.431	0.317	KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus OX=10090 GN=Klf4 PE=1 SV=3
10	A0A8I6B336	1.30e-65	217	481	0.431	0.318	A0A8I6B336_RAT Kruppel like factor 4 OS=Rattus norvegicus OX=10116 GN=Klf4 PE=4 SV=1
11	Q923V7	1.32e-65	217	482	0.431	0.317	Q923V7_RAT Kruppel like factor 4 OS=Rattus norvegicus OX=10116 GN=Klf4 PE=1 SV=1
12	A0A8I5ZW83	7.45e-65	215	509	0.431	0.301	A0A8I5ZW83_RAT Kruppel like factor 4 OS=Rattus norvegicus OX=10116 GN=Klf4 PE=4 SV=1
13	Q13351	1.14e-54	185	362	0.231	0.227	KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens OX=9606 GN=KLF1 PE=1 SV=1
14	B0BNN2	1.95e-54	184	368	0.273	0.264	B0BNN2_RAT Klf1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Klf1 PE=2 SV=1
15	A0A8I5ZPH7	7.80e-54	182	361	0.273	0.269	A0A8I5ZPH7_RAT Kruppel like factor 1 OS=Rattus norvegicus OX=10116 GN=Klf1 PE=4 SV=1
16	G3V6F3	1.88e-53	182	396	0.273	0.245	G3V6F3_RAT Kruppel like factor 1 OS=Rattus norvegicus OX=10116 GN=Klf1 PE=4 SV=2
17	P46099	7.57e-53	180	358	0.363	0.360	KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus OX=10090 GN=Klf1 PE=1 SV=2
18	Q90XE6	5.83e-51	175	365	0.361	0.351	KLF1_DANRE Kruppel-like factor 1 OS=Danio rerio OX=7955 GN=klf1 PE=2 SV=1
19	Q66HP1	4.84e-47	165	363	0.225	0.220	Q66HP1_RAT Klf5 protein OS=Rattus norvegicus OX=10116 GN=Klf5 PE=2 SV=1
20	F1LSL7	1.69e-46	166	443	0.225	0.181	F1LSL7_RAT Kruppel-like factor 5 OS=Rattus norvegicus OX=10116 GN=Klf5 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	1.4e+02	14.3	FOXP coiled-coil domain
2	PF00096 zf-C2H2	8e-13	59.2	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	9.2e-05	34.0	C2H2-type zinc finger
4	PF15909 zf-C2H2_8	9e+02	11.6	C2H2-type zinc ribbon
5	PF12171 zf-C2H2_jaz	2.5e+02	13.4	Zinc-finger double-stranded RNA-binding
6	PF13465 zf-H2C2_2	1.3e-06	39.8	Zinc-finger double domain
7	PF13909 zf-H2C2_5	6.6e+02	11.5	C2H2-type zinc-finger domain
8	PF12874 zf-met	42	15.9	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248071

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000226574	0.846	Nuclear factor NF-kappa-B p105 subunit
2	9606.ENSP00000427793	0.844	NEDD4-like E3 ubiquitin-protein ligase WWP1
3	9606.ENSP00000323588	0.843	Transcription factor SOX-2
4	9606.ENSP00000384273	0.843	Transcription factor p65
5	9606.ENSP00000263253	0.818	Histone acetyltransferase p300
6	9606.ENSP00000305416	0.746	Sphingosine 1-phosphate receptor 1
7	9606.ENSP00000259915	0.744	POU domain, class 5, transcription factor 1
8	9606.ENSP00000229307	0.736	Homeobox protein NANOG
9	9606.ENSP00000368880	0.714	Forkhead box protein O1
10	9606.ENSP00000311005	0.708	Mitogen-activated protein kinase 7
11	9606.ENSP00000422488	0.706	Steroid hormone receptor ERR2
12	9606.ENSP00000297494	0.687	Nitric oxide synthase, endothelial
13	9606.ENSP00000479618	0.666	Myc proto-oncogene protein
14	9606.ENSP00000236147	0.661	L-selectin
15	9606.ENSP00000263707	0.638	Transcription factor CP2-like protein 1
16	9606.ENSP00000216341	0.635	Granzyme B
17	9606.ENSP00000366307	0.617	Thrombomodulin
18	9606.ENSP00000311280	0.601	ETS-related transcription factor Elf-4
19	9606.ENSP00000246657	0.598	C-C chemokine receptor type 7
20	9606.ENSP00000363314	0.596	Protein lin-28 homolog A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000981	0.991	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.717	transcription cis-regulatory region binding
GO:0000977	0.418	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.384	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0010468	0.981	regulation of gene expression
GO:0080090	0.979	regulation of primary metabolic process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0050896	0.978	response to stimulus
GO:0031323	0.977	regulation of cellular metabolic process
GO:0048518	0.976	positive regulation of biological process
GO:0009889	0.976	regulation of biosynthetic process
GO:2001141	0.966	regulation of RNA biosynthetic process
GO:0006355	0.963	regulation of DNA-templated transcription
GO:0048519	0.934	negative regulation of biological process
GO:0032501	0.931	multicellular organismal process
GO:0010604	0.927	positive regulation of macromolecule metabolic process
GO:0006357	0.888	regulation of transcription by RNA polymerase II
GO:0051716	0.875	cellular response to stimulus
GO:0048522	0.875	positive regulation of cellular process
GO:0048523	0.870	negative regulation of cellular process
GO:0051173	0.830	positive regulation of nitrogen compound metabolic process
GO:0006950	0.794	response to stress
GO:0031325	0.776	positive regulation of cellular metabolic process
GO:0048583	0.737	regulation of response to stimulus
GO:0032502	0.728	developmental process
GO:0009892	0.718	negative regulation of metabolic process
GO:0045893	0.717	positive regulation of DNA-templated transcription
GO:0010605	0.713	negative regulation of macromolecule metabolic process
GO:0045944	0.709	positive regulation of transcription by RNA polymerase II
GO:0051239	0.700	regulation of multicellular organismal process
GO:0042221	0.693	response to chemical
GO:0051172	0.688	negative regulation of nitrogen compound metabolic process
GO:0031324	0.677	negative regulation of cellular metabolic process
GO:0048856	0.667	anatomical structure development
GO:0070887	0.657	cellular response to chemical stimulus
GO:0050793	0.624	regulation of developmental process
GO:0009890	0.605	negative regulation of biosynthetic process
GO:0023051	0.599	regulation of signaling
GO:0010646	0.598	regulation of cell communication
GO:0009966	0.586	regulation of signal transduction
GO:0051246	0.550	regulation of protein metabolic process
GO:0045934	0.519	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.515	negative regulation of macromolecule biosynthetic process
GO:0048584	0.514	positive regulation of response to stimulus
GO:0031327	0.514	negative regulation of cellular biosynthetic process
GO:0051253	0.513	negative regulation of RNA metabolic process
GO:0045892	0.487	negative regulation of DNA-templated transcription
GO:0010033	0.464	response to organic substance
GO:0034405	0.458	response to fluid shear stress
GO:0000122	0.419	negative regulation of transcription by RNA polymerase II
GO:2000026	0.376	regulation of multicellular organismal development
GO:0007275	0.365	multicellular organism development
GO:0008152	0.327	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.996	nucleus
GO:0005654	0.990	nucleoplasm
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005694	0.970	chromosome
GO:0000785	0.945	chromatin
GO:0005737	0.809	cytoplasm
GO:0032991	0.338	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]