StarFunc result for job id Q9Y5W5

User Input

>input (379 residues)
MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSE
GKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
VPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQA
ECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVN
CDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGY
QGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHT
PSLKKAEERRDPPESNYIW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9WUA1	0.837	0.837	1.563E-73	379	0.939	0.939	Q9WUA1.pdb.gz	WIF1_MOUSE Wnt inhibitory factor 1 OS=Mus musculus OX=10090 GN=Wif1 PE=2 SV=1
2	AFDB:Q9W6F9	0.772	0.774	6.576E-64	378	0.686	0.688	Q9W6F9.pdb.gz	WIF1_DANRE Wnt inhibitory factor 1 OS=Danio rerio OX=7955 GN=wif1 PE=2 SV=1
3	AFDB:Q9W3W5	0.364	0.305	2.224E-33	456	0.298	0.248	Q9W3W5.pdb.gz	WIF1_DROME Protein shifted OS=Drosophila melanogaster OX=7227 GN=shf PE=1 SV=2
4	AFDB:Q6GLP3	0.330	0.214	1.345E-12	599	0.124	0.078	Q6GLP3.pdb.gz	Q6GLP3_XENLA MGC84433 protein OS=Xenopus laevis OX=8355 GN=ryk.L PE=2 SV=1
5	AFDB:Q27324	0.334	0.214	2.664E-12	610	0.100	0.062	Q27324.pdb.gz	RYK1_DROME Tyrosine-protein kinase Drl OS=Drosophila melanogaster OX=7227 GN=drl PE=2 SV=1
6	AFDB:Q9IAT6	0.124	0.084	3.346E-12	664	0.190	0.108	Q9IAT6.pdb.gz	DLLC_DANRE Delta-like protein C OS=Danio rerio OX=7955 GN=dlc PE=2 SV=1
7	AFDB:Q7JQT0	0.344	0.208	5.277E-12	648	0.111	0.065	Q7JQT0.pdb.gz	Q7JQT0_DROME Derailed 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Drl-2 PE=1 SV=1
8	AFDB:Q9V422	0.343	0.227	5.587E-12	584	0.100	0.065	Q9V422.pdb.gz	RYK2_DROME Tyrosine-protein kinase Dnt OS=Drosophila melanogaster OX=7227 GN=dnt PE=2 SV=2
9	AFDB:Q90656	0.138	0.083	1.172E-11	728	0.253	0.132	Q90656.pdb.gz	Q90656_CHICK Delta-like protein OS=Gallus gallus OX=9031 PE=2 SV=1
10	AFDB:O57409	0.137	0.096	1.848E-11	615	0.245	0.151	O57409.pdb.gz	DLLB_DANRE Delta-like protein B OS=Danio rerio OX=7955 GN=dlb PE=1 SV=1
11	PDB:5es4B	0.146	0.094	1.669E-6	674	0.153	0.086	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
12	PDB:7nxdB	0.138	0.089	3.336E-4	690	0.135	0.074	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
13	PDB:4g1eB	0.131	0.080	8.785E-4	709	0.127	0.068	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
14	PDB:5ghuA	0.180	0.298	9.300E-4	201	0.034	0.065	5ghuA.pdb.gz
15	PDB:7sqcO0	0.181	0.071	2.593E-3	1140	0.050	0.017	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:1rowA	0.169	0.436	3.257E-3	107	0.032	0.112	1rowA.pdb.gz
17	PDB:4b0mM	0.151	0.234	3.257E-3	212	0.026	0.047	4b0mM.pdb.gz
18	PDB:7b0xC	0.171	0.267	5.438E-3	211	0.042	0.076	7b0xC.pdb.gz
19	PDB:7sqcO1	0.153	0.095	6.094E-3	673	0.042	0.024	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:2mspA	0.149	0.382	6.830E-3	124	0.037	0.113	2mspA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9W6F9	0.0	552	378	0.699	0.701	WIF1_DANRE Wnt inhibitory factor 1 OS=Danio rerio OX=7955 GN=wif1 PE=2 SV=1
2	Q9WUA1	0.0	735	379	0.939	0.939	WIF1_MOUSE Wnt inhibitory factor 1 OS=Mus musculus OX=10090 GN=Wif1 PE=2 SV=1
3	Q9Y5W5	0.0	782	379	1.000	1.000	WIF1_HUMAN Wnt inhibitory factor 1 OS=Homo sapiens OX=9606 GN=WIF1 PE=1 SV=3
4	Q9W3W5	1.06e-61	207	456	0.296	0.246	WIF1_DROME Protein shifted OS=Drosophila melanogaster OX=7227 GN=shf PE=1 SV=2
5	Q9DER5	2.25e-31	128	2802	0.169	0.023	TEN2_CHICK Teneurin-2 OS=Gallus gallus OX=9031 GN=TENM2 PE=1 SV=1
6	Q9NT68	1.03e-30	126	2774	0.166	0.023	TEN2_HUMAN Teneurin-2 OS=Homo sapiens OX=9606 GN=TENM2 PE=1 SV=3
7	Q9R1K2	1.25e-30	126	2774	0.166	0.023	TEN2_RAT Teneurin-2 OS=Rattus norvegicus OX=10116 GN=Tenm2 PE=1 SV=2
8	Q9WTS6	1.61e-29	122	2715	0.153	0.021	TEN3_MOUSE Teneurin-3 OS=Mus musculus OX=10090 GN=Tenm3 PE=1 SV=1
9	Q9WTS5	2.70e-29	122	2764	0.166	0.023	TEN2_MOUSE Teneurin-2 OS=Mus musculus OX=10090 GN=Tenm2 PE=1 SV=1
10	A0A5F8MPH8	2.71e-29	122	4356	0.164	0.014	A0A5F8MPH8_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
11	Q9P273	6.80e-29	121	2699	0.150	0.021	TEN3_HUMAN Teneurin-3 OS=Homo sapiens OX=9606 GN=TENM3 PE=1 SV=3
12	Q9W7R4	5.72e-27	115	2694	0.158	0.022	TEN3_DANRE Teneurin-3 OS=Danio rerio OX=7955 GN=tenm3 PE=2 SV=2
13	H1A489	9.38e-26	111	1356	0.140	0.039	H1A489_TAEGU Tenascin R OS=Taeniopygia guttata OX=59729 GN=TNR PE=3 SV=2
14	Q7T3T6	1.00e-25	111	1350	0.140	0.039	Q7T3T6_DANRE Tenascin-R OS=Danio rerio OX=7955 GN=tnr PE=1 SV=1
15	Q05546	5.17e-24	106	1356	0.177	0.049	TENR_RAT Tenascin-R OS=Rattus norvegicus OX=10116 GN=Tnr PE=1 SV=1
16	Q8BYI9	6.96e-24	105	1358	0.174	0.049	TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr PE=1 SV=2
17	F1QYE2	9.08e-24	105	1811	0.172	0.036	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
18	E9QHI1	1.30e-23	105	1720	0.172	0.038	E9QHI1_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
19	Q92752	3.75e-23	103	1358	0.142	0.040	TENR_HUMAN Tenascin-R OS=Homo sapiens OX=9606 GN=TNR PE=1 SV=3
20	A1L306	4.54e-23	103	1257	0.137	0.041	A1L306_HUMAN TNR protein OS=Homo sapiens OX=9606 GN=TNR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	9.1e-08	43.6	EGF-like domain
2	PF07974 EGF_2	7.1e-13	60.0	EGF-like domain
3	PF12661 hEGF	1.3e-07	43.2	Human growth factor-like EGF
4	PF02019 WIF	6e-32	121.6	WIF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286574

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293549	0.980	Proto-oncogene Wnt-1
2	9606.ENSP00000294304	0.977	Low-density lipoprotein receptor-related protein 5
3	9606.ENSP00000284523	0.965	Protein Wnt-3a
4	9606.ENSP00000261349	0.962	Low-density lipoprotein receptor-related protein 6
5	9606.ENSP00000287934	0.957	Frizzled-1
6	9606.ENSP00000323901	0.957	Frizzled-2
7	9606.ENSP00000285018	0.948	Protein Wnt-7a
8	9606.ENSP00000340677	0.943	Protein Wnt-8b
9	9606.ENSP00000426653	0.942	Protein Wnt-8a
10	9606.ENSP00000264634	0.940	Protein Wnt-5a
11	9606.ENSP00000360858	0.938	Noelin
12	9606.ENSP00000265441	0.927	Protein Wnt-2
13	9606.ENSP00000290167	0.924	Protein Wnt-4
14	9606.ENSP00000325526	0.891	Protein Wnt-11
15	9606.ENSP00000358698	0.860	Protein Wnt-2b
16	9606.ENSP00000308369	0.820	Inner nuclear membrane protein Man1
17	9606.ENSP00000363081	0.820	Dickkopf-related protein 1
18	9606.ENSP00000220772	0.819	Secreted frizzled-related protein 1
19	9606.ENSP00000301061	0.814	Protein Wnt-10b
20	9606.ENSP00000257868	0.812	Growth/differentiation factor 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.410	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.893	cellular process
GO:0048518	0.888	positive regulation of biological process
GO:0048522	0.863	positive regulation of cellular process
GO:0045595	0.815	regulation of cell differentiation
GO:0032502	0.798	developmental process
GO:0051094	0.748	positive regulation of developmental process
GO:0048856	0.657	anatomical structure development
GO:0048519	0.648	negative regulation of biological process
GO:0045598	0.640	regulation of fat cell differentiation
GO:0032501	0.619	multicellular organismal process
GO:0048523	0.569	negative regulation of cellular process
GO:0045597	0.524	positive regulation of cell differentiation
GO:0048583	0.522	regulation of response to stimulus
GO:0007275	0.487	multicellular organism development
GO:0050896	0.460	response to stimulus
GO:0009966	0.435	regulation of signal transduction
GO:0048731	0.425	system development
GO:0019222	0.413	regulation of metabolic process
GO:0048513	0.387	animal organ development
GO:0060255	0.384	regulation of macromolecule metabolic process
GO:0007154	0.379	cell communication
GO:0007165	0.369	signal transduction
GO:0045600	0.333	positive regulation of fat cell differentiation
GO:0080090	0.330	regulation of primary metabolic process
GO:0051171	0.330	regulation of nitrogen compound metabolic process
GO:0010468	0.326	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005576	0.993	extracellular region
GO:0071944	0.960	cell periphery
GO:0016020	0.945	membrane
GO:0005886	0.859	plasma membrane
GO:0005622	0.715	intracellular anatomical structure
GO:0043226	0.551	organelle
GO:0043231	0.375	intracellular membrane-bounded organelle
GO:0005737	0.373	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]