StarFunc result for job id Q9Y5W8

User Input

>input (968 residues)
MLTEASLSIWGWGSLGIVLFLITFGPFVIFYLTFYILCFVGGGLVVTLLFGKTNSEKYLE
QCEHSFLPPTSPGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWY
YTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQKIT
EKDDQVKGTAEDLVDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGD
FQNKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNI
GELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINTV
KLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEVL
LSRQRDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPE
IFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPT
GSINLSLDDLSNVSSDDSVQLHAYISDTVYADYDPYAVAGVCNDHGKTYALYAITVHRRN
LNSEEMWKTYRRYSDFHDFHMRITEQFESLSSILKLPGKKTFNNMDRDFLEKRKKDLNAY
LQLLLAPEMMKASPALAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKS
LPDSLAEGMTKMSDNMGKMSERLGQDIKQSFFKVPPLIPKTDSDPEHRRVSAQLDDNVDD
NIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQ
VADSVKRFRDAFWPNGILAEAVPCRDKSIRMRTRVAGKTKLLAIMPDELKHIIGAETTRK
GILRVFEMFQHNQLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSKQMQKYKQKLQTT
QAPSLQKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QM62	0.870	0.881	0.000	955	0.788	0.799	F1QM62.pdb.gz	F1QM62_DANRE Sorting nexin 13 OS=Danio rerio OX=7955 GN=snx13 PE=3 SV=3
2	AFDB:Q9Y5W8	1.000	1.000	0.000	968	1.000	1.000	Q9Y5W8.pdb.gz	SNX13_HUMAN Sorting nexin-13 OS=Homo sapiens OX=9606 GN=SNX13 PE=1 SV=4
3	AFDB:A0A494C0S0	0.310	0.300	3.851E-27	1004	0.210	0.202	A0A494C0S0.pdb.gz	A0A494C0S0_HUMAN Sorting nexin 25 OS=Homo sapiens OX=9606 GN=SNX25 PE=1 SV=1
4	AFDB:Q3ZT31	0.301	0.343	1.023E-26	840	0.205	0.236	Q3ZT31.pdb.gz	SNX25_MOUSE Sorting nexin-25 OS=Mus musculus OX=10090 GN=Snx25 PE=1 SV=3
5	AFDB:Q8T4E8	0.313	0.273	2.576E-25	1117	0.218	0.189	Q8T4E8.pdb.gz	Q8T4E8_DROME AT01932p OS=Drosophila melanogaster OX=7227 GN=snz PE=2 SV=1
6	AFDB:Q5PNP1	0.302	0.312	2.748E-23	934	0.181	0.187	Q5PNP1.pdb.gz	SNX14_DANRE Sorting nexin-14 OS=Danio rerio OX=7955 GN=snx14 PE=2 SV=3
7	AFDB:Q9USN1	0.307	0.296	1.322E-22	1010	0.178	0.170	Q9USN1.pdb.gz	SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snx12 PE=3 SV=1
8	AFDB:Q8BHY8	0.300	0.301	5.143E-22	964	0.191	0.192	Q8BHY8.pdb.gz	SNX14_MOUSE Sorting nexin-14 OS=Mus musculus OX=10090 GN=Snx14 PE=1 SV=2
9	AFDB:Q01846	0.327	0.283	2.666E-20	1127	0.185	0.159	Q01846.pdb.gz	MDM1_YEAST Structural protein MDM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDM1 PE=1 SV=3
10	AFDB:F4IJE1	0.349	0.340	1.692E-17	994	0.188	0.183	F4IJE1.pdb.gz	F4IJE1_ARATH Phox domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=SNX4 PE=1 SV=1
11	PDB:1ocuA	0.113	0.685	5.528E-4	134	0.026	0.187	1ocuA.pdb.gz	Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
12	PDB:1agrE	0.115	0.813	1.238E-3	128	0.030	0.227	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
13	PDB:6pjxA	0.123	0.214	2.774E-3	543	0.034	0.061	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
14	PDB:7shfC	0.114	0.265	7.366E-3	400	0.067	0.163	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
15	PDB:2mxcA	0.111	0.527	9.108E-3	172	0.031	0.174	2mxcA.pdb.gz
16	PDB:4yhjA	0.121	0.227	1.175E-2	501	0.028	0.054	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
17	PDB:4pzgA	0.104	0.552	2.418E-2	152	0.024	0.151	4pzgA.pdb.gz
18	PDB:3pvuA	0.111	0.172	7.292E-2	609	0.028	0.044	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
19	PDB:6bfiB	0.075	0.084	7.292E-2	806	0.115	0.138	6bfiB.pdb.gz
20	PDB:3uzsA	0.127	0.193	1.069E-1	609	0.023	0.036	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QM62	0.0	1578	955	0.790	0.801	F1QM62_DANRE Sorting nexin 13 OS=Danio rerio OX=7955 GN=snx13 PE=3 SV=3
2	Q9Y5W8	0.0	2012	968	1.000	1.000	SNX13_HUMAN Sorting nexin-13 OS=Homo sapiens OX=9606 GN=SNX13 PE=1 SV=4
3	A0A494C0S0	3.22e-48	188	1004	0.243	0.234	A0A494C0S0_HUMAN Sorting nexin 25 OS=Homo sapiens OX=9606 GN=SNX25 PE=1 SV=1
4	Q9H3E2	1.18e-46	182	840	0.227	0.262	SNX25_HUMAN Sorting nexin-25 OS=Homo sapiens OX=9606 GN=SNX25 PE=1 SV=2
5	Q3ZT31	2.59e-45	178	840	0.226	0.261	SNX25_MOUSE Sorting nexin-25 OS=Mus musculus OX=10090 GN=Snx25 PE=1 SV=3
6	Q9W3N0	3.18e-23	108	1117	0.138	0.120	Q9W3N0_DROME FI21262p1 OS=Drosophila melanogaster OX=7227 GN=snz PE=2 SV=2
7	Q8T4E8	2.71e-22	105	1117	0.132	0.115	Q8T4E8_DROME AT01932p OS=Drosophila melanogaster OX=7227 GN=snz PE=2 SV=1
8	Q8BHY8	3.78e-19	95.9	964	0.183	0.184	SNX14_MOUSE Sorting nexin-14 OS=Mus musculus OX=10090 GN=Snx14 PE=1 SV=2
9	D6RJG9	3.12e-15	83.2	935	0.073	0.076	D6RJG9_HUMAN Sorting nexin 14 OS=Homo sapiens OX=9606 GN=SNX14 PE=1 SV=2
10	Q9Y5W7	3.60e-15	82.8	946	0.073	0.075	SNX14_HUMAN Sorting nexin-14 OS=Homo sapiens OX=9606 GN=SNX14 PE=1 SV=3
11	Q5PNP1	4.70e-15	82.4	934	0.068	0.071	SNX14_DANRE Sorting nexin-14 OS=Danio rerio OX=7955 GN=snx14 PE=2 SV=3
12	Q6P4T1	3.12e-13	76.6	997	0.063	0.061	SNX19_MOUSE Sorting nexin-19 OS=Mus musculus OX=10090 GN=Snx19 PE=1 SV=1
13	F4IJE1	1.25e-10	68.2	994	0.080	0.077	F4IJE1_ARATH Phox domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=SNX4 PE=1 SV=1
14	Q92543	1.74e-10	67.8	992	0.056	0.054	SNX19_HUMAN Sorting nexin-19 OS=Homo sapiens OX=9606 GN=SNX19 PE=1 SV=2
15	Q9USN1	2.21e-09	63.9	1010	0.073	0.070	SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snx12 PE=3 SV=1
16	C9J715	1.15e-07	58.2	583	0.035	0.058	C9J715_HUMAN Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=1
17	Q80TM9	1.50e-07	58.2	1593	0.036	0.022	NISCH_MOUSE Nischarin OS=Mus musculus OX=10090 GN=Nisch PE=1 SV=2
18	Q4G017	2.01e-07	57.8	1502	0.036	0.023	NISCH_RAT Nischarin OS=Rattus norvegicus OX=10116 GN=Nisch PE=2 SV=2
19	Q9Y2I1	2.14e-07	57.8	1504	0.035	0.023	NISCH_HUMAN Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=3
20	Q8BX57	2.51e-06	53.9	582	0.040	0.067	PXK_MOUSE PX domain-containing protein kinase-like protein OS=Mus musculus OX=10090 GN=Pxk PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02284 COX5A	4.5e+02	12.3	Cytochrome c oxidase subunit Va
2	PF08628 Nexin_C	3e-24	97.1	Sorting nexin C terminal
3	PF00787 PX	6.9e-18	76.5	PX domain
4	PF02194 PXA	1.4e-51	186.7	PXA domain
5	PF00615 RGS	5.5e-16	70.3	Regulator of G protein signaling domain
6	PF07962 Swi3	1e+02	14.3	Replication Fork Protection Component Swi3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008976954.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003825059.1	0.700	Ankyrin repeat and MYND domain-containing protein 2
2	9597.XP_003825064.1	0.689	Basic leucine zipper and W2 domains 2
3	9597.XP_003825076.1	0.676	Fer3 like bHLH transcription factor
4	9597.XP_003825067.1	0.675	Belongs to the tetraspanin (TM4SF) family.
5	9597.XP_003809776.1	0.674	HEPACAM family member 2
6	9597.XP_003829853.1	0.666	Ribonuclease P/MRP subunit p25 like
7	9597.XP_003825068.1	0.664	Anterior gradient 3, protein disulphide isomerase family member
8	9597.XP_008957650.1	0.660	Retention in endoplasmic reticulum sorting receptor 1
9	9597.XP_003806804.1	0.646	pre-mRNA processing factor 18
10	9597.XP_008955338.1	0.642	BEN domain containing 7
11	9597.XP_003806486.1	0.618	Forty-two-three domain containing 1
12	9597.XP_008974564.1	0.615	Thioredoxin domain-containing protein 12
13	9597.XP_003812555.1	0.585	PC-esterase domain-containing protein 1B-like
14	9597.XP_003821341.1	0.585	PC-esterase domain containing 1A
15	9597.XP_003832932.1	0.569	Belongs to the OSBP family.
16	9597.XP_003807500.1	0.564	Vacuolar protein sorting 36 homolog
17	9597.XP_003818732.1	0.563	Serpin family E member 2
18	9597.XP_003828013.1	0.562	Caseinolytic mitochondrial matrix peptidase chaperone subunit
19	9597.XP_003826806.1	0.561	E3 ubiquitin-protein ligase Praja-2
20	9597.XP_003826743.1	0.560	Sorting nexin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032266	0.998	phosphatidylinositol-3-phosphate binding
GO:0005515	0.933	protein binding
GO:0003824	0.395	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.986	cellular process
GO:0006810	0.956	transport
GO:0051641	0.905	cellular localization
GO:0046907	0.869	intracellular transport
GO:0071705	0.785	nitrogen compound transport
GO:0071702	0.780	organic substance transport
GO:0050789	0.728	regulation of biological process
GO:0050794	0.710	regulation of cellular process
GO:0033036	0.687	macromolecule localization
GO:0051336	0.663	regulation of hydrolase activity
GO:0043087	0.551	regulation of GTPase activity
GO:0044093	0.509	positive regulation of molecular function
GO:0015031	0.436	protein transport
GO:0043547	0.338	positive regulation of GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	0.998	endosome
GO:0005769	0.994	early endosome
GO:0005829	0.854	cytosol
GO:0016020	0.707	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]