StarFunc result for job id Q9Y5Y2

User Input

>input (271 residues)
MEAAAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILDVDLCGPSIPR
MLGAQGRAVHQCDRGWAPVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSD
VAWGELDYLVVDTPPGTSDEHMATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKT
GLRVMGIVENMSGFTCPHCTECTSVFSRGGGEELAQLAGVPFLGSVPLDPALMRTLEEGH
DFIQEFPGSPAFAALTSIAQKILDATPACLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5Y2	1.000	1.000	4.689E-58	271	1.000	1.000	Q9Y5Y2.pdb.gz	NUBP2_HUMAN Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens OX=9606 GN=NUBP2 PE=1 SV=1
2	AFDB:Q9R061	0.951	0.937	1.883E-49	275	0.838	0.825	Q9R061.pdb.gz	NUBP2_MOUSE Cytosolic Fe-S cluster assembly factor NUBP2 OS=Mus musculus OX=10090 GN=Nubp2 PE=1 SV=1
3	AFDB:Q9VPD2	0.926	0.964	1.079E-37	260	0.509	0.531	Q9VPD2.pdb.gz	NUBP2_DROME Cytosolic Fe-S cluster assembly factor Nubp2 homolog OS=Drosophila melanogaster OX=7227 GN=Nubp2 PE=1 SV=1
4	AFDB:Q4Q9E8	0.928	0.819	3.958E-36	308	0.524	0.461	Q4Q9E8.pdb.gz	Q4Q9E8_LEIMA Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Leishmania major OX=5664 GN=LMJF_26_0430 PE=3 SV=1
5	AFDB:P53384	0.924	0.785	5.675E-36	320	0.491	0.416	P53384.pdb.gz	NUBP1_HUMAN Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1 PE=1 SV=2
6	AFDB:P40558	0.902	0.836	1.315E-35	293	0.498	0.461	P40558.pdb.gz	CFD1_YEAST Cytosolic Fe-S cluster assembly factor CFD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CFD1 PE=1 SV=1
7	AFDB:P52920	0.924	0.766	8.456E-35	328	0.469	0.387	P52920.pdb.gz	NBP35_YEAST Cytosolic Fe-S cluster assembly factor NBP35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NBP35 PE=1 SV=1
8	AFDB:O94442	0.920	0.789	8.980E-35	317	0.487	0.416	O94442.pdb.gz	NBP35_SCHPO Cytosolic Fe-S cluster assembly factor nbp35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nbp35 PE=3 SV=1
9	AFDB:Q57WQ0	0.911	0.855	9.535E-35	289	0.520	0.488	Q57WQ0.pdb.gz	Q57WQ0_TRYB2 Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.840 PE=3 SV=1
10	AFDB:Q9R060	0.928	0.788	2.809E-34	320	0.498	0.422	Q9R060.pdb.gz	NUBP1_MOUSE Cytosolic Fe-S cluster assembly factor NUBP1 OS=Mus musculus OX=10090 GN=Nubp1 PE=1 SV=1
11	PDB:7ejwA	0.645	0.638	4.405E-13	274	0.225	0.223	7ejwA.pdb.gz	The antiactivator FleN uses an allosteric mechanism to regulate sigma 54 -dependent expression of flagellar genes in Pseudomonas aeruginosa .
12	PDB:3q9lA	0.652	0.684	1.061E-11	257	0.188	0.198	3q9lA.pdb.gz	Determination of the structure of the MinD-ATP complex reveals the orientation of MinD on the membrane and the relative location of the binding sites for MinE and MinC.
13	PDB:2afhE	0.593	0.561	1.853E-9	289	0.173	0.163	2afhE.pdb.gz	Nitrogenase Complexes: Multiple Docking Sites for a Nucleotide Switch Protein
14	PDB:4zdjA	0.472	0.269	2.870E-7	535	0.151	0.077	4zdjA.pdb.gz	Thiophenecarboxamide Derivatives Activated by EthA Kill Mycobacterium tuberculosis by Inhibiting the CTP Synthetase PyrG.
15	PDB:3ug7A	0.540	0.471	8.457E-7	317	0.162	0.139	3ug7A.pdb.gz	Tail-anchor targeting by a Get3 tetramer: the structure of an archaeal homologue.
16	PDB:6so5B	0.521	0.489	1.142E-6	292	0.162	0.151	6so5B.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
17	PDB:7miiA	0.441	0.265	1.212E-6	497	0.185	0.101	7miiA.pdb.gz	Structural basis for isoform-specific inhibition of human CTPS1.
18	PDB:3ez2B	0.552	0.401	1.960E-6	394	0.196	0.135	3ez2B.pdb.gz	Structural basis for ADP-mediated transcriptional regulation by P1 and P7 ParA.
19	PDB:3sjbA	0.501	0.475	2.492E-6	288	0.166	0.156	3sjbA.pdb.gz
20	PDB:1a82A	0.463	0.545	3.572E-6	224	0.125	0.152	1a82A.pdb.gz	Snapshot of a phosphorylated substrate intermediate by kinetic crystallography.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y5Y2	0.0	551	271	1.000	1.000	NUBP2_HUMAN Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens OX=9606 GN=NUBP2 PE=1 SV=1
2	Q9R061	1.96e-169	471	275	0.841	0.829	NUBP2_MOUSE Cytosolic Fe-S cluster assembly factor NUBP2 OS=Mus musculus OX=10090 GN=Nubp2 PE=1 SV=1
3	Q9VPD2	2.32e-107	313	260	0.513	0.535	NUBP2_DROME Cytosolic Fe-S cluster assembly factor Nubp2 homolog OS=Drosophila melanogaster OX=7227 GN=Nubp2 PE=1 SV=1
4	P40558	5.25e-100	296	293	0.480	0.444	CFD1_YEAST Cytosolic Fe-S cluster assembly factor CFD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CFD1 PE=1 SV=1
5	Q57WQ0	2.31e-99	294	289	0.513	0.481	Q57WQ0_TRYB2 Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.840 PE=3 SV=1
6	Q4Q9E8	1.54e-95	285	308	0.509	0.448	Q4Q9E8_LEIMA Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Leishmania major OX=5664 GN=LMJF_26_0430 PE=3 SV=1
7	Q9R060	2.22e-95	285	320	0.498	0.422	NUBP1_MOUSE Cytosolic Fe-S cluster assembly factor NUBP1 OS=Mus musculus OX=10090 GN=Nubp1 PE=1 SV=1
8	P53384	5.53e-94	281	320	0.494	0.419	NUBP1_HUMAN Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1 PE=1 SV=2
9	O94442	3.92e-92	276	317	0.476	0.407	NBP35_SCHPO Cytosolic Fe-S cluster assembly factor nbp35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nbp35 PE=3 SV=1
10	P52920	3.39e-89	270	328	0.469	0.387	NBP35_YEAST Cytosolic Fe-S cluster assembly factor NBP35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NBP35 PE=1 SV=1
11	Q9UT57	6.57e-89	277	608	0.476	0.212	CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC806.02c PE=3 SV=1
12	Q8H1Q2	9.96e-89	269	350	0.506	0.391	NBP35_ARATH Cytosolic Fe-S cluster assembly factor NBP35 OS=Arabidopsis thaliana OX=3702 GN=NBP35 PE=1 SV=1
13	Q93459	2.00e-84	257	313	0.454	0.393	NUBP1_CAEEL Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Caenorhabditis elegans OX=6239 GN=nubp-1 PE=2 SV=2
14	Q38C73	1.16e-81	249	312	0.439	0.381	Q38C73_TRYB2 Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6210 PE=3 SV=1
15	Q9VJI9	2.51e-74	231	311	0.443	0.386	NUBP1_DROME Cytosolic Fe-S cluster assembly factor Nubp1 homolog OS=Drosophila melanogaster OX=7227 GN=Nubp1 PE=1 SV=1
16	O49472	8.71e-52	173	313	0.354	0.307	INDH_ARATH Iron-sulfur protein required for NADH dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=INDH PE=2 SV=1
17	Q9CWD8	2.23e-47	162	319	0.365	0.310	NUBPL_MOUSE Iron-sulfur protein NUBPL OS=Mus musculus OX=10090 GN=Nubpl PE=1 SV=2
18	Q8TB37	2.56e-47	162	319	0.358	0.304	NUBPL_HUMAN Iron-sulfur protein NUBPL OS=Homo sapiens OX=9606 GN=NUBPL PE=1 SV=3
19	X5D2R5	2.56e-47	162	319	0.358	0.304	X5D2R5_HUMAN Nucleotide binding protein-like isoform A (Fragment) OS=Homo sapiens OX=9606 GN=NUBPL PE=2 SV=1
20	P0AF08	1.57e-46	161	369	0.376	0.276	APBC_ECOLI Iron-sulfur cluster carrier protein OS=Escherichia coli (strain K12) OX=83333 GN=mrp PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	4.2e+02	12.7	AAA ATPase domain
2	PF13238 AAA_18	7.5e+02	12.1	AAA domain
3	PF13481 AAA_25	12	17.0	AAA domain
4	PF13500 AAA_26	0.11	23.8	AAA domain
5	PF13604 AAA_30	6.1e+02	11.5	AAA domain
6	PF13614 AAA_31	2.3e-05	35.9	AAA domain
7	PF01583 APS_kinase	15	16.9	Adenylylsulphate kinase
8	PF02374 ArsA_ATPase	0.0079	27.0	Anion-transporting ATPase
9	PF01656 CbiA	8.7e-10	50.2	CobQ/CobB/MinD/ParA nucleotide binding domain
10	PF06564 CBP_BcsQ	0.39	21.7	Cellulose biosynthesis protein BcsQ
11	PF16575 CLP1_P	2.9e+02	12.7	mRNA cleavage and polyadenylation factor CLP1 P-loop
12	PF00142 Fer4_NifH	0.16	22.9	4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
13	PF08433 KTI12	4.6e+02	11.6	Chromatin associated protein KTI12
14	PF03308 MeaB	0.089	23.3	Methylmalonyl Co-A mutase-associated GTPase MeaB
15	PF09140 MipZ	2.6e-05	35.2	ATPase MipZ
16	PF00931 NB-ARC	1.4e+02	13.0	NB-ARC domain
17	PF03266 NTPase_1	5.6e+02	11.8	NTPase
18	PF10609 ParA	1.5e-94	327.6	NUBPL iron-transfer P-loop NTPase
19	PF03193 RsgA_GTPase	5.9e+02	11.8	RsgA GTPase
20	PF00448 SRP54	92	14.1	SRP54-type protein, GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262302

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251588	0.987	Cytosolic Fe-S cluster assembly factor NARFL
2	9606.ENSP00000377914	0.980	Anamorsin
3	9606.ENSP00000360576	0.979	NADPH-dependent diflavin oxidoreductase 1
4	9606.ENSP00000418287	0.977	Probable cytosolic iron-sulfur protein assembly protein CIAO1
5	9606.ENSP00000412698	0.975	MMS19 nucleotide excision repair protein homolog
6	9606.ENSP00000253577	0.972	ATP-binding cassette sub-family B member 7, mitochondrial
7	9606.ENSP00000387471	0.970	Mitotic spindle-associated MMXD complex subunit MIP18
8	9606.ENSP00000283027	0.933	Cytosolic Fe-S cluster assembly factor NUBP1
9	9606.ENSP00000406046	0.931	DNA polymerase delta catalytic subunit
10	9606.ENSP00000375809	0.928	TFIIH basal transcription factor complex helicase XPD subunit
11	9606.ENSP00000353332	0.917	Regulator of telomere elongation helicase 1
12	9606.ENSP00000259008	0.909	Fanconi anemia group J protein
13	9606.ENSP00000216027	0.781	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
14	9606.ENSP00000263578	0.767	FAD-dependent oxidoreductase domain-containing protein 1
15	9606.ENSP00000310623	0.746	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
16	9606.ENSP00000309477	0.730	Cytoplasmic aconitate hydratase
17	9606.ENSP00000363205	0.723	Cysteine desulfurase, mitochondrial
18	9606.ENSP00000420026	0.714	LYR motif-containing protein 4
19	9606.ENSP00000302665	0.712	Insulin-like growth factor I
20	9606.ENSP00000289359	0.686	MIT domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.968	heterocyclic compound binding
GO:0097159	0.968	organic cyclic compound binding
GO:0000166	0.955	nucleotide binding
GO:0003824	0.677	catalytic activity
GO:0042802	0.315	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044237	0.991	cellular metabolic process
GO:0071704	0.984	organic substance metabolic process
GO:0006807	0.974	nitrogen compound metabolic process
GO:0034641	0.872	cellular nitrogen compound metabolic process
GO:0071840	0.856	cellular component organization or biogenesis
GO:0044238	0.837	primary metabolic process
GO:0043170	0.796	macromolecule metabolic process
GO:0065007	0.792	biological regulation
GO:0016043	0.789	cellular component organization
GO:0046483	0.727	heterocycle metabolic process
GO:0050789	0.697	regulation of biological process
GO:0044085	0.645	cellular component biogenesis
GO:0022607	0.644	cellular component assembly
GO:0010467	0.641	gene expression
GO:0006725	0.606	cellular aromatic compound metabolic process
GO:1901360	0.590	organic cyclic compound metabolic process
GO:0050794	0.572	regulation of cellular process
GO:0031163	0.419	metallo-sulfur cluster assembly
GO:0006790	0.404	sulfur compound metabolic process
GO:0006139	0.312	nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0043229	0.993	intracellular organelle
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0016020	0.970	membrane
GO:0070013	0.962	intracellular organelle lumen
GO:0005829	0.958	cytosol
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0005634	0.910	nucleus
GO:0005856	0.859	cytoskeleton
GO:0032991	0.774	protein-containing complex
GO:0071944	0.746	cell periphery
GO:0005886	0.718	plasma membrane
GO:0015630	0.534	microtubule cytoskeleton
GO:0005654	0.424	nucleoplasm
GO:0005813	0.395	centrosome
GO:0000922	0.328	spindle pole
GO:1902494	0.302	catalytic complex
GO:0031616	0.300	spindle pole centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]