StarFunc result for job id Q9Y5Y9

User Input

>input (1956 residues)
MEFPIGSLETNNFRRFTPESLVEIEKQIAAKQGTKKAREKHREQKDQEEKPRPQLDLKAC
NQLPKFYGELPAELIGEPLEDLDPFYSTHRTFMVLNKGRTISRFSATRALWLFSPFNLIR
RTAIKVSVHSWFSLFITVTILVNCVCMTRTDLPEKIEYVFTVIYTFEALIKILARGFCLN
EFTYLRDPWNWLDFSVITLAYVGTAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI
HSVKKLADVTILTIFCLSVFALVGLQLFKGNLKNKCVKNDMAVNETTNYSSHRKPDIYIN
KRGTSDPLLCGNGSDSGHCPDGYICLKTSDNPDFNYTSFDSFAWAFLSLFRLMTQDSWER
LYQQTLRTSGKIYMIFFVLVIFLGSFYLVNLILAVVTMAYEEQNQATTDEIEAKEKKFQE
ALEMLRKEQEVLAALGIDTTSLHSHNGSPLTSKNASERRHRIKPRVSEGSTEDNKSPRSD
PYNQRRMSFLGLASGKRRASHGSVFHFRSPGRDISLPEGVTDDGVFPGDHESHRGSLLLG
GGAGQQGPLPRSPLPQPSNPDSRHGEDEHQPPPTSELAPGAVDVSAFDAGQKKTFLSAEY
LDEPFRAQRAMSVVSIITSVLEELEESEQKCPPCLTSLSQKYLIWDCCPMWVKLKTILFG
LVTDPFAELTITLCIVVNTIFMAMEHHGMSPTFEAMLQIGNIVFTIFFTAEMVFKIIAFD
PYYYFQKKWNIFDCIIVTVSLLELGVAKKGSLSVLRSFRLLRVFKLAKSWPTLNTLIKII
GNSVGALGNLTIILAIIVFVFALVGKQLLGENYRNNRKNISAPHEDWPRWHMHDFFHSFL
IVFRILCGEWIENMWACMEVGQKSICLILFLTVMVLGNLVVLNLFIALLLNSFSADNLTA
PEDDGEVNNLQVALARIQVFGHRTKQALCSFFSRSCPFPQPKAEPELVVKLPLSSSKAEN
HIAANTARGSSGGLQAPRGPRDEHSDFIANPTVWVSVPIAEGESDLDDLEDDGGEDAQSF
QQEVIPKGQQEQLQQVERCGDHLTPRSPGTGTSSEDLAPSLGETWKDESVPQVPAEGVDD
TSSSEGSTVDCLDPEEILRKIPELADDLEEPDDCFTEGCIRHCPCCKLDTTKSPWDVGWQ
VRKTCYRIVEHSWFESFIIFMILLSSGSLAFEDYYLDQKPTVKALLEYTDRVFTFIFVFE
MLLKWVAYGFKKYFTNAWCWLDFLIVNISLISLTAKILEYSEVAPIKALRTLRALRPLRA
LSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFWRCINYTDGEFSL
VPLSIVNNKSDCKIQNSTGSFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVDSR
EVNMQPKWEDNVYMYLYFVIFIIFGGFFTLNLFVGVIIDNFNQQKKKLGGQDIFMTEEQK
KYYNAMKKLGSKKPQKPIPRPLNKFQGFVFDIVTRQAFDITIMVLICLNMITMMVETDDQ
SEEKTKILGKINQFFVAVFTGECVMKMFALRQYYFTNGWNVFDFIVVVLSIASLIFSAIL
KSLQSYFSPTLFRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMFI
YSIFGMSSFPHVRWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDP
NLPNSNGTRGDCGSPAVGIIFFTTYIIISFLIMVNMYIAVILENFNVATEESTEPLSEDD
FDMFYETWEKFDPEATQFITFSALSDFADTLSGPLRIPKPNRNILIQMDLPLVPGDKIHC
LDILFAFTKNVLGESGELDSLKANMEEKFMATNLSKSSYEPIATTLRWKQEDISATVIQK
AYRSYVLHRSMALSNTPCVPRAEEEAASLPDEGFVAFTANENCVLPDKSETASATSFPPS
YESVTRGLSDRVNMRTSSSIQNEDEATSMELIAPGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7w9lA	0.649	0.887	0.000	1420	0.485	0.668	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
2	PDB:7we4A	0.560	0.967	0.000	1122	0.572	0.997	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
3	PDB:7xveA	0.593	0.890	0.000	1276	0.431	0.661	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
4	AFDB:A2APX8	0.775	0.756	0.000	2009	0.566	0.551	A2APX8.pdb.gz	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
5	AFDB:B1AWN6	0.764	0.745	0.000	2006	0.570	0.556	B1AWN6.pdb.gz	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
6	AFDB:F1LQQ7	0.702	0.799	0.000	1704	0.359	0.413	F1LQQ7.pdb.gz	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
7	AFDB:F1QXF5	0.771	0.756	0.000	1996	0.568	0.557	F1QXF5.pdb.gz	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
8	AFDB:P08104	0.768	0.770	0.000	1951	0.572	0.573	P08104.pdb.gz	SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn3a PE=1 SV=1
9	AFDB:Q01118	0.722	0.835	0.000	1682	0.390	0.453	Q01118.pdb.gz	SCN7A_HUMAN Sodium channel protein type 7 subunit alpha OS=Homo sapiens OX=9606 GN=SCN7A PE=1 SV=2
10	AFDB:Q15858	0.774	0.762	0.000	1988	0.561	0.552	Q15858.pdb.gz	SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens OX=9606 GN=SCN9A PE=1 SV=3
11	AFDB:Q6QIY3	0.849	0.848	0.000	1958	0.820	0.819	Q6QIY3.pdb.gz	SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus OX=10090 GN=Scn10a PE=1 SV=2
12	AFDB:Q9ER60	0.761	0.807	0.000	1841	0.549	0.583	Q9ER60.pdb.gz	SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus OX=10090 GN=Scn4a PE=1 SV=1
13	AFDB:Q9R053	0.748	0.826	0.000	1765	0.492	0.546	Q9R053.pdb.gz	SCNBA_MOUSE Sodium channel protein type 11 subunit alpha OS=Mus musculus OX=10090 GN=Scn11a PE=1 SV=2
14	PDB:6j8eA	0.562	0.956	2.355E-99	1139	0.420	0.722	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
15	PDB:6j8gA	0.561	0.954	3.493E-97	1140	0.398	0.683	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
16	PDB:6lqaB	0.566	0.953	4.163E-97	1151	0.440	0.747	6lqaB.pdb.gz	Structural Basis for Pore Blockade of the Human Cardiac Sodium Channel Na v 1.5 by the Antiarrhythmic Drug Quinidine*.
17	PDB:6agfA	0.563	0.960	6.314E-96	1138	0.416	0.715	6agfA.pdb.gz	Structure of the human voltage-gated sodium channel Nav1.4 in complex with beta 1.
18	PDB:6uz3A	0.554	0.953	9.165E-95	1126	0.437	0.759	6uz3A.pdb.gz	Structure of the Cardiac Sodium Channel.
19	PDB:7tj9A	0.543	0.946	2.348E-77	1111	0.289	0.509	7tj9A.pdb.gz	Structure-guided unlocking of Na X reveals a non-selective tetrodotoxin-sensitive cation channel.
20	PDB:7mixA	0.534	0.771	1.799E-51	1326	0.186	0.274	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT39	2341	1962	0.634	0.633	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
2	A0A0R4IUM7	1961	1955	0.552	0.552	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
3	A0A1B0GVX7	1599	1618	0.450	0.544	A0A1B0GVX7_HUMAN Sodium voltage-gated channel alpha subunit 1 OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
4	A0A1W2PPJ3	2079	1998	0.571	0.559	A0A1W2PPJ3_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
5	A0A286YEQ8	1151	1915	0.346	0.353	A0A286YEQ8_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
6	A0A286YF26	2078	1997	0.572	0.560	A0A286YF26_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
7	A0A590UK43	1472	1939	0.421	0.424	A0A590UK43_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
8	A0A8I6GH51	936	1672	0.270	0.316	A0A8I6GH51_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=3 SV=1
9	A2APX8	2095	2009	0.574	0.559	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
10	A2ASI5	2069	1947	0.573	0.575	SCN3A_MOUSE Sodium channel protein type 3 subunit alpha OS=Mus musculus OX=10090 GN=Scn3a PE=1 SV=1
11	B1AWN6	2123	2006	0.583	0.568	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
12	B1AYL1	977	1681	0.278	0.323	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
13	E9PG18	2305	1998	0.635	0.622	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
14	E9PHB6	2285	1983	0.632	0.624	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
15	F1LQQ7	946	1680	0.271	0.316	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
16	F1QXF5	2100	1996	0.576	0.565	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
17	H9KVD2	2355	2016	0.644	0.625	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
18	K4DIA1	2343	1962	0.635	0.634	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	O08562	2043	1984	0.572	0.564	SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1
20	O88420	2019	1978	0.571	0.564	SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn8a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20077 CcmD_alt	12	17.3	CcmD family protein
2	PF16905 GPHH	12	17.2	Voltage-dependent L-type calcium channel, IQ-associated
3	PF00520 Ion_trans	6e-248	829.8	Ion transport protein
4	PF06512 Na_trans_assoc	5.7e-57	204.8	Sodium ion transport-associated
5	PF11933 Na_trans_cytopl	1	21.0	Cytoplasmic domain of voltage-gated Na+ ion channel
6	PF08016 PKD_channel	4.9e-13	60.5	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000390600

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396915	0.906	Sodium channel subunit beta-1
2	9606.ENSP00000281142	0.899	Sodium channel and clathrin linker 1
3	9606.ENSP00000278947	0.894	Sodium channel subunit beta-2
4	9606.ENSP00000376523	0.886	Sodium channel subunit beta-3
5	9606.ENSP00000322460	0.883	Sodium channel subunit beta-4
6	9606.ENSP00000459962	0.852	Transient receptor potential cation channel, subfamily V, member 1
7	9606.ENSP00000461007	0.852	Transient receptor potential cation channel subfamily V member 1
8	9606.ENSP00000307078	0.840	Kinesin-1 heavy chain
9	9606.ENSP00000410257	0.834	Sodium channel protein type 5 subunit alpha
10	9606.ENSP00000252826	0.832	Transient receptor potential cation channel subfamily M member 4
11	9606.ENSP00000280772	0.817	Ankyrin-3
12	9606.ENSP00000357801	0.790	Protein S100-A10
13	9606.ENSP00000262209	0.781	Transient receptor potential cation channel subfamily A member 1
14	9606.ENSP00000364586	0.779	Sodium channel protein type 2 subunit alpha
15	9606.ENSP00000396320	0.778	Sodium channel protein type 4 subunit alpha
16	9606.ENSP00000300061	0.764	Amiloride-sensitive sodium channel subunit gamma
17	9606.ENSP00000265709	0.761	Ankyrin-1
18	9606.ENSP00000356265	0.753	Neuron navigator 1
19	9606.ENSP00000353292	0.750	Amiloride-sensitive sodium channel subunit alpha
20	9606.ENSP00000311165	0.733	Aquaporin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0005515	0.996	protein binding
GO:0022836	0.823	gated channel activity
GO:0022839	0.797	monoatomic ion gated channel activity
GO:0005244	0.738	voltage-gated monoatomic ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006810	0.992	transport
GO:0009987	0.990	cellular process
GO:0065007	0.981	biological regulation
GO:0032501	0.979	multicellular organismal process
GO:0030001	0.976	metal ion transport
GO:0050789	0.970	regulation of biological process
GO:0042391	0.970	regulation of membrane potential
GO:0006814	0.939	sodium ion transport
GO:0098662	0.927	inorganic cation transmembrane transport
GO:0098655	0.927	monoatomic cation transmembrane transport
GO:1903522	0.876	regulation of blood circulation
GO:0008016	0.874	regulation of heart contraction
GO:0003008	0.869	system process
GO:0050794	0.857	regulation of cellular process
GO:0035725	0.825	sodium ion transmembrane transport
GO:0061337	0.784	cardiac conduction
GO:0050896	0.622	response to stimulus
GO:0001508	0.617	action potential
GO:0050877	0.552	nervous system process
GO:0007154	0.484	cell communication
GO:0007600	0.477	sensory perception
GO:0023052	0.446	signaling
GO:0032502	0.362	developmental process
GO:0043269	0.354	regulation of monoatomic ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0032991	0.951	protein-containing complex
GO:0043226	0.889	organelle
GO:0034703	0.845	cation channel complex
GO:0098797	0.841	plasma membrane protein complex
GO:0043227	0.821	membrane-bounded organelle
GO:0005622	0.776	intracellular anatomical structure
GO:0005737	0.723	cytoplasm
GO:0034706	0.650	sodium channel complex
GO:0043229	0.591	intracellular organelle
GO:0031982	0.567	vesicle
GO:0005576	0.525	extracellular region
GO:0043231	0.516	intracellular membrane-bounded organelle
GO:0001518	0.513	voltage-gated sodium channel complex
GO:0005654	0.328	nucleoplasm
GO:0005615	0.321	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]