StarFunc result for job id Q9Y5Z0

User Input

>input (518 residues)
MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGL
ALALEPALASPAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
TPHSYIDTYFDTERSSTYRSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATI
FESENFFLPGIKWNGILGLAYATLAKPSSSLETFFDSLVTQANIPNVFSMQMCGAGLPVA
GSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKA
IVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISI
YLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD
RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCG
AILLVLIVLLLLPFRCQRRPRDPEVVNDESSLVRHRWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5Z0	1.000	1.000	0.000	518	1.000	1.000	Q9Y5Z0.pdb.gz	BACE2_HUMAN Beta-secretase 2 OS=Homo sapiens OX=9606 GN=BACE2 PE=1 SV=1
2	AFDB:Q6IE75	0.919	0.926	1.273E-96	514	0.890	0.897	Q6IE75.pdb.gz	BACE2_RAT Beta-secretase 2 OS=Rattus norvegicus OX=10116 GN=Bace2 PE=2 SV=1
3	AFDB:X4Z0F5	0.777	0.870	1.745E-71	462	0.548	0.615	X4Z0F5.pdb.gz
4	AFDB:Q6NZT7	0.751	0.769	1.606E-59	505	0.440	0.451	Q6NZT7.pdb.gz	Q6NZT7_DANRE Beta-secretase 1 OS=Danio rerio OX=7955 GN=zgc:77409 PE=2 SV=1
5	AFDB:P56817	0.767	0.793	1.191E-58	501	0.442	0.457	P56817.pdb.gz	BACE1_HUMAN Beta-secretase 1 OS=Homo sapiens OX=9606 GN=BACE1 PE=1 SV=3
6	AFDB:Q5XJ89	0.585	0.812	4.084E-45	372	0.382	0.532	Q5XJ89.pdb.gz	Q5XJ89_DANRE Beta-secretase 1 OS=Danio rerio OX=7955 GN=zgc:103530 PE=2 SV=1
7	AFDB:Q9VQ13	0.537	0.669	3.842E-26	410	0.187	0.237	Q9VQ13.pdb.gz	Q9VQ13_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG31926 PE=3 SV=1
8	AFDB:O76856	0.542	0.723	4.540E-26	383	0.176	0.238	O76856.pdb.gz	CATD_DICDI Cathepsin D OS=Dictyostelium discoideum OX=44689 GN=ctsD PE=1 SV=1
9	AFDB:F4K4L3	0.567	0.471	8.373E-26	631	0.199	0.163	F4K4L3.pdb.gz	F4K4L3_ARATH Eukaryotic aspartyl protease family protein OS=Arabidopsis thaliana OX=3702 GN=MMG4.12 PE=1 SV=1
10	AFDB:P20142	0.500	0.654	8.373E-26	388	0.189	0.253	P20142.pdb.gz	PEPC_HUMAN Gastricsin OS=Homo sapiens OX=9606 GN=PGC PE=1 SV=1
11	PDB:5ux4B	0.530	0.790	9.365E-26	340	0.172	0.262	5ux4B.pdb.gz	Development of 2-aminooxazoline 3-azaxanthene beta-amyloid cleaving enzyme (BACE) inhibitors with improved selectivity against Cathepsin D.
12	PDB:2bjuA	0.518	0.787	3.898E-24	329	0.158	0.249	2bjuA.pdb.gz	X-Ray Structure of Plasmepsin II Complexed with a Potent Achiral Inhibitor.
13	PDB:4amtA	0.513	0.744	8.497E-24	349	0.162	0.241	4amtA.pdb.gz
14	PDB:1tzsA	0.498	0.776	1.062E-23	322	0.168	0.270	1tzsA.pdb.gz	Crystal structure of an activation intermediate of cathepsin e
15	PDB:5mktA	0.479	0.737	2.678E-22	329	0.166	0.261	5mktA.pdb.gz
16	PDB:2qzwA	0.501	0.742	3.953E-22	341	0.143	0.217	2qzwA.pdb.gz
17	PDB:3qvcA	0.474	0.641	4.419E-22	368	0.164	0.231	3qvcA.pdb.gz
18	PDB:3aupA	0.453	0.602	3.122E-16	377	0.116	0.159	3aupA.pdb.gz
19	PDB:2avoA	0.123	0.530	7.102E-2	99	0.025	0.131	2avoA.pdb.gz	Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S.
20	PDB:2d73A	0.089	0.071	2.162E-1	717	0.089	0.064	2d73A.pdb.gz	Structural and functional analysis of a glycoside hydrolase family 97 enzyme from Bacteroides thetaiotaomicron.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IE75	0.0	894	514	0.857	0.864	BACE2_RAT Beta-secretase 2 OS=Rattus norvegicus OX=10116 GN=Bace2 PE=2 SV=1
2	Q9JL18	0.0	890	514	0.857	0.864	BACE2_MOUSE Beta-secretase 2 OS=Mus musculus OX=10090 GN=Bace2 PE=1 SV=1
3	Q9Y5Z0	0.0	1056	518	1.000	1.000	BACE2_HUMAN Beta-secretase 2 OS=Homo sapiens OX=9606 GN=BACE2 PE=1 SV=1
4	P56819	7.66e-158	460	501	0.427	0.441	BACE1_RAT Beta-secretase 1 OS=Rattus norvegicus OX=10116 GN=Bace1 PE=2 SV=1
5	P56818	8.00e-158	460	501	0.427	0.441	BACE1_MOUSE Beta-secretase 1 OS=Mus musculus OX=10090 GN=Bace1 PE=1 SV=2
6	P56817	1.64e-157	459	501	0.429	0.443	BACE1_HUMAN Beta-secretase 1 OS=Homo sapiens OX=9606 GN=BACE1 PE=1 SV=3
7	Q6NZT7	1.28e-152	447	505	0.444	0.455	Q6NZT7_DANRE Beta-secretase 1 OS=Danio rerio OX=7955 GN=zgc:77409 PE=2 SV=1
8	Q5XJ89	1.05e-145	424	372	0.407	0.567	Q5XJ89_DANRE Beta-secretase 1 OS=Danio rerio OX=7955 GN=zgc:103530 PE=2 SV=1
9	P20142	3.58e-28	118	388	0.172	0.229	PEPC_HUMAN Gastricsin OS=Homo sapiens OX=9606 GN=PGC PE=1 SV=1
10	P70269	7.48e-26	111	397	0.178	0.232	CATE_MOUSE Cathepsin E OS=Mus musculus OX=10090 GN=Ctse PE=1 SV=2
11	P24268	8.11e-26	111	407	0.201	0.256	CATD_RAT Cathepsin D OS=Rattus norvegicus OX=10116 GN=Ctsd PE=1 SV=1
12	P18242	2.26e-25	110	410	0.201	0.254	CATD_MOUSE Cathepsin D OS=Mus musculus OX=10090 GN=Ctsd PE=1 SV=1
13	O93428	2.29e-25	110	396	0.205	0.268	CATD_CHIHA Cathepsin D OS=Chionodraco hamatus OX=36188 GN=ctsd PE=1 SV=2
14	Q9VLK3	3.69e-25	108	372	0.195	0.272	Q9VLK3_DROME Beta-site APP-cleaving enzyme, isoform A OS=Drosophila melanogaster OX=7227 GN=Bace PE=2 SV=1
15	P16228	3.79e-25	109	398	0.180	0.234	CATE_RAT Cathepsin E OS=Rattus norvegicus OX=10116 GN=Ctse PE=1 SV=3
16	Q05744	5.68e-24	105	398	0.185	0.241	CATD_CHICK Cathepsin D OS=Gallus gallus OX=9031 GN=CTSD PE=1 SV=1
17	P07339	5.80e-24	106	412	0.199	0.250	CATD_HUMAN Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1
18	O76856	9.59e-24	105	383	0.203	0.274	CATD_DICDI Cathepsin D OS=Dictyostelium discoideum OX=44689 GN=ctsD PE=1 SV=1
19	P06281	1.76e-23	104	402	0.241	0.311	RENI1_MOUSE Renin-1 OS=Mus musculus OX=10090 GN=Ren1 PE=1 SV=1
20	P00797	8.73e-23	102	406	0.168	0.214	RENI_HUMAN Renin OS=Homo sapiens OX=9606 GN=REN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00026 Asp	3.1e-43	160.0	Eukaryotic aspartyl protease
2	PF14541 TAXi_C	1.8e-07	42.6	Xylanase inhibitor C-terminal
3	PF14543 TAXi_N	0.00025	32.8	Xylanase inhibitor N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332979

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367050	0.943	Reticulon-3
2	9606.ENSP00000337838	0.894	Reticulon-4
3	9606.ENSP00000369699	0.888	Collectrin
4	9606.ENSP00000284981	0.826	Amyloid-beta A4 protein
5	9606.ENSP00000318585	0.816	Beta-secretase 1
6	9606.ENSP00000269305	0.779	Cellular tumor antigen p53
7	9606.ENSP00000346643	0.761	Putative hexokinase HKDC1
8	9606.ENSP00000420037	0.756	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
9	9606.ENSP00000294785	0.721	Nicastrin
10	9606.ENSP00000248933	0.686	Seizure 6-like protein
11	9606.ENSP00000398481	0.686	Calcium-dependent secretion activator 2
12	9606.ENSP00000350673	0.684	Protein FAM3B
13	9606.ENSP00000290399	0.677	Single-minded homolog 2
14	9606.ENSP00000332513	0.676	SH3 domain-binding glutamic acid-rich protein
15	9606.ENSP00000326366	0.648	Presenilin-1
16	9606.ENSP00000481917	0.637	Seizure 6-like protein 2
17	9606.ENSP00000260408	0.633	Disintegrin and metalloproteinase domain-containing protein 10
18	9606.ENSP00000261879	0.632	Gamma-secretase subunit APH-1B
19	9606.ENSP00000245923	0.631	Reticulon-2
20	9606.ENSP00000267484	0.612	Reticulon-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004190	1.000	aspartic-type endopeptidase activity
GO:0005515	0.996	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0016043	0.989	cellular component organization
GO:0044238	0.985	primary metabolic process
GO:0033059	0.984	cellular pigmentation
GO:0006807	0.978	nitrogen compound metabolic process
GO:0016050	0.973	vesicle organization
GO:0050794	0.969	regulation of cellular process
GO:0051604	0.969	protein maturation
GO:0048753	0.963	pigment granule organization
GO:0016485	0.950	protein processing
GO:0032438	0.943	melanosome organization
GO:0019222	0.769	regulation of metabolic process
GO:0060255	0.720	regulation of macromolecule metabolic process
GO:0080090	0.709	regulation of primary metabolic process
GO:0051171	0.709	regulation of nitrogen compound metabolic process
GO:0032501	0.592	multicellular organismal process
GO:0048518	0.538	positive regulation of biological process
GO:0050896	0.513	response to stimulus
GO:0051246	0.472	regulation of protein metabolic process
GO:0048519	0.462	negative regulation of biological process
GO:0009892	0.451	negative regulation of metabolic process
GO:0010605	0.440	negative regulation of macromolecule metabolic process
GO:0031323	0.395	regulation of cellular metabolic process
GO:0032502	0.375	developmental process
GO:0007275	0.369	multicellular organism development
GO:0048522	0.352	positive regulation of cellular process
GO:0051172	0.327	negative regulation of nitrogen compound metabolic process
GO:0048523	0.310	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031982	0.998	vesicle
GO:0005886	0.996	plasma membrane
GO:0031410	0.991	cytoplasmic vesicle
GO:0031090	0.962	organelle membrane
GO:0030659	0.951	cytoplasmic vesicle membrane
GO:0005794	0.913	Golgi apparatus
GO:0098588	0.865	bounding membrane of organelle
GO:0099503	0.830	secretory vesicle
GO:0005768	0.505	endosome
GO:0070013	0.497	intracellular organelle lumen
GO:0005829	0.398	cytosol
GO:0030141	0.349	secretory granule
GO:0031981	0.339	nuclear lumen
GO:0005654	0.312	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.23.-	1.000	Aspartic endopeptidases.

[back to server]