StarFunc result for job id Q9Y5Z4

User Input

>input (205 residues)
MAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMDWDS
AIQTGFTKLNSYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQFDPP
RPLESDVFIEDRAEMTVFVRSFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTAGYN
SPVKLLNRNNEVWLIQKNEPTKENE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y5Z4	1.000	1.000	3.144E-37	205	1.000	1.000	Q9Y5Z4.pdb.gz	HEBP2_HUMAN Heme-binding protein 2 OS=Homo sapiens OX=9606 GN=HEBP2 PE=1 SV=1
2	AFDB:Q9WU63	0.899	0.899	4.212E-30	205	0.839	0.839	Q9WU63.pdb.gz	HEBP2_MOUSE Heme-binding protein 2 OS=Mus musculus OX=10090 GN=Hebp2 PE=1 SV=1
3	PDB:4ayzA	0.848	0.941	4.438E-28	184	0.893	0.995	4ayzA.pdb.gz
4	AFDB:Q9SHG8	0.769	0.684	2.078E-16	232	0.371	0.328	Q9SHG8.pdb.gz	Q9SHG8_ARATH At1g17100 OS=Arabidopsis thaliana OX=3702 GN=HBP1 PE=1 SV=1
5	AFDB:Q9NRV9	0.794	0.858	1.176E-14	189	0.254	0.275	Q9NRV9.pdb.gz	HEBP1_HUMAN Heme-binding protein 1 OS=Homo sapiens OX=9606 GN=HEBP1 PE=1 SV=1
6	AFDB:Q9R257	0.799	0.860	1.241E-14	190	0.259	0.279	Q9R257.pdb.gz	HEBP1_MOUSE Heme-binding protein 1 OS=Mus musculus OX=10090 GN=Hebp1 PE=1 SV=2
7	AFDB:F4IRX7	0.761	0.641	4.143E-12	246	0.288	0.240	F4IRX7.pdb.gz	F4IRX7_ARATH SOUL heme-binding family protein OS=Arabidopsis thaliana OX=3702 GN=SOUL-1 PE=1 SV=2
8	PDB:2hvaA	0.721	0.773	9.572E-12	190	0.263	0.284	2hvaA.pdb.gz
9	AFDB:Q9SR77	0.740	0.502	9.389E-11	309	0.239	0.159	Q9SR77.pdb.gz	HBPL1_ARATH Heme-binding-like protein At3g10130, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g10130 PE=1 SV=1
10	AFDB:F4K452	0.743	0.396	9.908E-11	395	0.229	0.119	F4K452.pdb.gz	F4K452_ARATH SOUL heme-binding family protein OS=Arabidopsis thaliana OX=3702 GN=HBP5 PE=1 SV=1
11	PDB:5xbtA	0.521	0.408	1.752E-5	271	0.117	0.089	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
12	PDB:1jyhA	0.536	0.674	7.095E-5	155	0.112	0.148	1jyhA.pdb.gz
13	AFDB:P33012	0.594	0.748	8.089E-5	157	0.102	0.134	P33012.pdb.gz	SBMC_ECOLI DNA gyrase inhibitor OS=Escherichia coli (strain K12) OX=83333 GN=sbmC PE=1 SV=1
14	AFDB:Q9HUT5	0.507	0.402	9.506E-5	270	0.083	0.063	Q9HUT5.pdb.gz	Q9HUT5_PSEAE Probable transcriptional regulator OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA4878 PE=1 SV=1
15	PDB:1d5yA	0.469	0.356	2.473E-3	288	0.102	0.073	1d5yA.pdb.gz	Crystal structure of the Escherichia coli Rob transcription factor in complex with DNA.
16	PDB:5it0A	0.222	0.141	5.604E-2	396	0.102	0.053	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
17	PDB:6u9hG	0.239	0.271	8.168E-2	169	0.073	0.089	6u9hG.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.
18	PDB:2j0wA	0.246	0.146	1.735E-1	447	0.073	0.034	2j0wA.pdb.gz	Structures of R- and T-State Escherichia Coli Aspartokinase III: Mechanisms of the Allosteric Transition and Inhibition by Lysine.
19	PDB:4iofB	0.165	0.055	1.932E-1	861	0.122	0.029	4iofB.pdb.gz	Conformational states and recognition of amyloidogenic peptides of human insulin-degrading enzyme.
20	PDB:6hfwA	0.282	0.171	1.932E-1	429	0.093	0.044	6hfwA.pdb.gz	Novel insight into the reaction of nitro, nitroso and hydroxylamino benzothiazinones and of benzoxacinones with Mycobacterium tuberculosis DprE1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y5Z4	2.71e-152	422	205	1.000	1.000	HEBP2_HUMAN Heme-binding protein 2 OS=Homo sapiens OX=9606 GN=HEBP2 PE=1 SV=1
2	Q9WU63	3.23e-125	353	205	0.839	0.839	HEBP2_MOUSE Heme-binding protein 2 OS=Mus musculus OX=10090 GN=Hebp2 PE=1 SV=1
3	Q9SHG8	1.12e-30	114	232	0.351	0.310	Q9SHG8_ARATH At1g17100 OS=Arabidopsis thaliana OX=3702 GN=HBP1 PE=1 SV=1
4	Q9R257	1.29e-21	89.7	190	0.263	0.284	HEBP1_MOUSE Heme-binding protein 1 OS=Mus musculus OX=10090 GN=Hebp1 PE=1 SV=2
5	Q9NRV9	3.46e-19	83.2	189	0.249	0.270	HEBP1_HUMAN Heme-binding protein 1 OS=Homo sapiens OX=9606 GN=HEBP1 PE=1 SV=1
6	F4IRX7	3.13e-07	51.6	246	0.288	0.240	F4IRX7_ARATH SOUL heme-binding family protein OS=Arabidopsis thaliana OX=3702 GN=SOUL-1 PE=1 SV=2
7	F4K452	0.011	38.5	395	0.229	0.119	F4K452_ARATH SOUL heme-binding family protein OS=Arabidopsis thaliana OX=3702 GN=HBP5 PE=1 SV=1
8	Q9SR77	0.020	37.4	309	0.254	0.168	HBPL1_ARATH Heme-binding-like protein At3g10130, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g10130 PE=1 SV=1
9	Q9M021	2.1	31.6	682	0.117	0.035	LRK62_ARATH L-type lectin-domain containing receptor kinase VI.2 OS=Arabidopsis thaliana OX=3702 GN=LECRK62 PE=2 SV=1
10	P0ABN5	2.4	31.2	433	0.088	0.042	DCUA_ECOLI C4-dicarboxylate transporter DcuA OS=Escherichia coli (strain K12) OX=83333 GN=dcuA PE=1 SV=1
11	F4KHQ8	3.8	30.8	733	0.078	0.022	NCER3_ARATH Neutral ceramidase 3 OS=Arabidopsis thaliana OX=3702 GN=NCER3 PE=2 SV=1
12	F4HQM3	4.3	30.8	779	0.078	0.021	NCER1_ARATH Neutral ceramidase 1 OS=Arabidopsis thaliana OX=3702 GN=NCER1 PE=2 SV=1
13	Q6P9P6	9.6	29.6	1052	0.107	0.021	KIF11_MOUSE Kinesin-like protein KIF11 OS=Mus musculus OX=10090 GN=Kif11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17048 Ceramidse_alk_C	1.5e+02	13.6	Neutral/alkaline non-lysosomal ceramidase, C-terminal
2	PF08237 PE-PPE	30	15.6	PE-PPE domain
3	PF04832 SOUL	6.9e-42	155.0	SOUL heme-binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000475750

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264933	0.983	Programmed cell death protein 6
2	9606.ENSP00000260665	0.855	Leucine-rich PPR motif-containing protein, mitochondrial
3	9606.ENSP00000325313	0.829	Microtubule-associated protein 1S
4	9606.ENSP00000341219	0.816	Cat eye syndrome critical region protein 2
5	9606.ENSP00000337393	0.748	Protein UXT
6	9606.ENSP00000361708	0.662	Transcription elongation factor A like family
7	9606.ENSP00000353165	0.518	Thiamin pyrophosphokinase 1
8	9606.ENSP00000221797	0.508	Galactoside-binding soluble lectin 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.521	heterocyclic compound binding
GO:0097159	0.517	organic cyclic compound binding
GO:0003824	0.341	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.995	cellular component organization
GO:0042391	0.993	regulation of membrane potential
GO:0010939	0.993	regulation of necrotic cell death
GO:0046902	0.993	regulation of mitochondrial membrane permeability
GO:0051881	0.980	regulation of mitochondrial membrane potential
GO:0010942	0.974	positive regulation of cell death
GO:0010940	0.392	positive regulation of necrotic cell death
GO:0008152	0.354	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0012505	0.994	endomembrane system
GO:0005576	0.994	extracellular region
GO:0005615	0.975	extracellular space
GO:0031410	0.947	cytoplasmic vesicle
GO:0005773	0.916	vacuole
GO:0005739	0.909	mitochondrion
GO:0043230	0.894	extracellular organelle
GO:0070062	0.802	extracellular exosome
GO:0099503	0.793	secretory vesicle
GO:0005764	0.774	lysosome
GO:0030141	0.747	secretory granule
GO:0031983	0.738	vesicle lumen
GO:0005766	0.736	primary lysosome
GO:0005775	0.720	vacuolar lumen
GO:0042582	0.720	azurophil granule
GO:0034774	0.720	secretory granule lumen
GO:0005634	0.625	nucleus
GO:0031981	0.491	nuclear lumen
GO:0035578	0.491	azurophil granule lumen
GO:0016020	0.350	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]