StarFunc result for job id Q9Y5Z6

User Input

>input (326 residues)
MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINP
HSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQISPEEMHRIWNDMSSKKHLRC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54904	0.847	0.847	5.942E-71	326	1.000	1.000	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
2	AFDB:O43825	0.805	0.623	1.046E-42	422	0.463	0.358	O43825.pdb.gz	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
3	AFDB:Q9Y2C3	0.784	0.824	2.269E-36	310	0.383	0.403	Q9Y2C3.pdb.gz	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
4	AFDB:Q9JI67	0.776	0.821	1.496E-33	308	0.368	0.390	Q9JI67.pdb.gz	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
5	AFDB:O75752	0.770	0.759	4.843E-33	331	0.359	0.353	O75752.pdb.gz	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
6	PDB:7jhiC	0.765	0.754	5.094E-31	331	0.301	0.296	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
7	AFDB:Q6ZMB0	0.770	0.657	6.809E-31	384	0.285	0.242	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
8	AFDB:Q9Y2A9	0.762	0.671	7.243E-31	372	0.301	0.263	Q9Y2A9.pdb.gz	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
9	AFDB:Q8NFL0	0.774	0.635	2.345E-30	401	0.282	0.229	Q8NFL0.pdb.gz	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
10	AFDB:Q9Z222	0.772	0.638	3.194E-30	397	0.334	0.275	Q9Z222.pdb.gz	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
11	AFDB:Q9BYG0	0.766	0.663	4.628E-30	378	0.301	0.259	Q9BYG0.pdb.gz	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
12	PDB:6fxrA	0.357	0.188	6.473E-6	700	0.080	0.037	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:4fixA	0.379	0.213	3.036E-5	629	0.089	0.046	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
14	PDB:1ll0B	0.394	0.463	4.681E-5	267	0.092	0.112	1ll0B.pdb.gz
15	PDB:4y63A	0.381	0.430	6.783E-5	282	0.101	0.117	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
16	PDB:8cvzI	0.321	0.376	9.829E-5	267	0.095	0.116	8cvzI.pdb.gz
17	PDB:3r2wC	0.263	0.204	1.112E-4	450	0.083	0.060	3r2wC.pdb.gz
18	PDB:7d72A	0.324	0.276	1.612E-4	407	0.098	0.079	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
19	PDB:7x8kB	0.271	0.249	2.812E-4	367	0.077	0.068	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
20	PDB:1h5sB	0.313	0.340	3.384E-4	291	0.086	0.096	1h5sB.pdb.gz	Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54904	0.0	685	326	1.000	1.000	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
2	Q9Y5Z6	0.0	685	326	1.000	1.000	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
3	O54905	3.25e-100	303	422	0.436	0.336	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
4	O43825	3.04e-99	300	422	0.439	0.339	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
5	Q9Y2C3	2.93e-72	228	310	0.353	0.371	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
6	Q9JI67	1.85e-69	220	308	0.340	0.360	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
7	O75752	6.56e-63	204	331	0.340	0.335	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
8	Q920V1	4.40e-62	202	331	0.334	0.329	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
9	Q9NY97	5.25e-54	183	397	0.337	0.277	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
10	Q9Z222	2.75e-53	181	397	0.340	0.280	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
11	Q99NB2	1.61e-50	174	377	0.304	0.263	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
12	Q8BGY6	3.66e-49	170	376	0.304	0.263	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
13	Q9BYG0	4.76e-48	167	378	0.291	0.251	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
14	Q9Y2A9	1.20e-46	163	372	0.267	0.234	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
15	Q8K0J2	2.77e-45	160	397	0.261	0.214	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
16	Q6ZMB0	3.03e-45	160	384	0.264	0.224	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
17	Q9C0J1	1.28e-44	158	378	0.267	0.230	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
18	Q8NFL0	1.21e-43	156	401	0.255	0.207	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
19	O96024	1.44e-40	147	378	0.285	0.246	B3GT4_HUMAN Beta-1,3-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GALT4 PE=1 SV=1
20	Q9VLS8	1.52e-40	151	585	0.258	0.144	Q9VLS8_DROME LD29807p OS=Drosophila melanogaster OX=7227 GN=GalT4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19341 B3GALT2_N	0.046	25.8	Beta-1,3-galactosyltransferase 2 N-terminus
2	PF01762 Galactosyl_T	2.8e-57	205.2	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006153635.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006160962.1	0.990	Galactoside 2-alpha-L-fucosyltransferase 2-like
2	246437.XP_006153821.1	0.989	CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X1
3	246437.XP_006147441.1	0.985	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
4	246437.XP_006160248.1	0.969	Galactoside 2-alpha-L-fucosyltransferase 1 isoform X1
5	246437.XP_006143293.1	0.959	Beta-1,4-galactosyltransferase 1
6	246437.XP_006167693.1	0.959	Beta-1,4-galactosyltransferase 4 isoform X1
7	246437.XP_006150545.1	0.957	N-acetyllactosaminide alpha-1,3-galactosyltransferase-like isoform X1
8	246437.XP_006153828.1	0.954	Beta-1,4-galactosyltransferase 2
9	246437.XP_006163178.1	0.934	Beta-1,4-galactosyltransferase 3
10	246437.XP_006140682.1	0.918	ST3 beta-galactoside alpha-2,3-sialyltransferase 4
11	246437.XP_006172443.1	0.887	ST3 beta-galactoside alpha-2,3-sialyltransferase 5
12	246437.XP_006158223.1	0.866	Hexosyltransferase
13	246437.XP_006146089.1	0.823	Beta-1,3-galactosyltransferase 2-like isoform X1
14	246437.XP_006154114.1	0.710	Belongs to the glycosyltransferase 29 family.
15	246437.XP_006170354.1	0.638	Alpha-(1,3)-fucosyltransferase 5
16	246437.XP_006150752.1	0.611	Lactosylceramide 4-alpha-galactosyltransferase
17	246437.XP_006166214.1	0.611	Beta-1,4 N-acetylgalactosaminyltransferase 2 isoform X1
18	246437.XP_006142739.1	0.561	Multiple C2 and transmembrane domain-containing protein 2
19	246437.XP_006154119.1	0.558	Belongs to the glycosyltransferase 29 family.
20	246437.XP_006165601.1	0.556	glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048531	1.000	beta-1,3-galactosyltransferase activity
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0008499	0.986	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
GO:0005515	0.634	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009312	0.996	oligosaccharide biosynthetic process
GO:0044237	0.986	cellular metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:1901564	0.974	organonitrogen compound metabolic process
GO:1901135	0.973	carbohydrate derivative metabolic process
GO:0044249	0.969	cellular biosynthetic process
GO:1901566	0.962	organonitrogen compound biosynthetic process
GO:1901137	0.959	carbohydrate derivative biosynthetic process
GO:0070085	0.764	glycosylation
GO:0043170	0.568	macromolecule metabolic process
GO:0009100	0.526	glycoprotein metabolic process
GO:0034645	0.513	cellular macromolecule biosynthetic process
GO:0006486	0.492	protein glycosylation
GO:0006643	0.442	membrane lipid metabolic process
GO:0006664	0.418	glycolipid metabolic process
GO:0046467	0.418	membrane lipid biosynthetic process
GO:0009247	0.354	glycolipid biosynthetic process
GO:0006665	0.314	sphingolipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]