StarFunc result for job id Q9Y600

User Input

>input (493 residues)
MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLEL
RSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEI
APVFVLMEEEVLRKLRALVGWSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLP
PLALFTSKECHYSIQKGAAFLGLGTDSVRVVKADERGKMVPEDLERQIGMAEAEGAVPFL
VSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQRADSVA
WNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRV
DCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPS
LRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMD
FLLNELERLGQDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q64611	0.981	0.981	3.199E-82	493	0.897	0.897	Q64611.pdb.gz	CSAD_RAT Cysteine sulfinic acid decarboxylase OS=Rattus norvegicus OX=10116 GN=Csad PE=1 SV=1
2	PDB:6zekC	0.965	0.996	7.155E-77	478	0.876	0.904	6zekC.pdb.gz	Structure and substrate specificity determinants of the taurine biosynthetic enzyme cysteine sulphinic acid decarboxylase.
3	AFDB:F1QG14	0.974	0.883	4.534E-71	544	0.629	0.570	F1QG14.pdb.gz	F1QG14_DANRE Cysteine sulfinic acid decarboxylase OS=Danio rerio OX=7955 GN=zgc:103478 PE=1 SV=1
4	AFDB:Q6ZQY3	0.965	0.913	1.267E-67	521	0.586	0.555	Q6ZQY3.pdb.gz	GADL1_HUMAN Acidic amino acid decarboxylase GADL1 OS=Homo sapiens OX=9606 GN=GADL1 PE=1 SV=4
5	AFDB:Q24062	0.974	0.836	3.011E-60	575	0.517	0.443	Q24062.pdb.gz	Q24062_DROME Black, isoform A OS=Drosophila melanogaster OX=7227 GN=b PE=1 SV=1
6	AFDB:F1R9E8	0.968	0.819	5.523E-60	583	0.513	0.434	F1R9E8.pdb.gz	F1R9E8_DANRE Glutamate decarboxylase 2 OS=Danio rerio OX=7955 GN=GAD65 PE=1 SV=1
7	AFDB:P48320	0.967	0.816	1.065E-59	585	0.519	0.438	P48320.pdb.gz	DCE2_MOUSE Glutamate decarboxylase 2 OS=Mus musculus OX=10090 GN=Gad2 PE=1 SV=1
8	AFDB:Q7ZUS3	0.955	0.804	3.965E-59	587	0.507	0.426	Q7ZUS3.pdb.gz	Q7ZUS3_DANRE GAD67 OS=Danio rerio OX=7955 GN=GAD67 PE=1 SV=1
9	AFDB:Q8IVA8	0.954	0.793	6.573E-59	594	0.519	0.431	Q8IVA8.pdb.gz	Q8IVA8_HUMAN Glutamate decarboxylase 1 (Brain, 67kDa) OS=Homo sapiens OX=9606 GN=GAD1 PE=1 SV=1
10	AFDB:G5EDB7	0.968	0.939	6.914E-59	508	0.462	0.449	G5EDB7.pdb.gz	G5EDB7_CAEEL Glutamate decarboxylase 1 OS=Caenorhabditis elegans OX=6239 GN=unc-25 PE=1 SV=1
11	AFDB:F1Q5U5	0.970	0.783	6.723E-58	613	0.503	0.405	F1Q5U5.pdb.gz
12	PDB:6khnA	0.856	0.861	7.296E-29	490	0.243	0.245	6khnA.pdb.gz	Crystal structure ofOryza sativaTDC reveals the substrate specificity for TDC-mediated melatonin biosynthesis.
13	PDB:6jrlA	0.796	0.842	2.109E-28	465	0.219	0.232	6jrlA.pdb.gz
14	PDB:6eeiB	0.797	0.832	5.238E-28	471	0.213	0.223	6eeiB.pdb.gz	Structural basis for divergent and convergent evolution of catalytic machineries in plant aromatic amino acid decarboxylase proteins.
15	PDB:3k40A	0.767	0.839	9.826E-27	448	0.215	0.237	3k40A.pdb.gz
16	PDB:3rchA	0.731	0.803	2.626E-25	446	0.191	0.211	3rchA.pdb.gz	Open conformation of human DOPA decarboxylase reveals the mechanism of PLP addition to Group II decarboxylases.
17	PDB:3f9tA	0.695	0.859	6.785E-21	394	0.156	0.195	3f9tA.pdb.gz	Crystal structure of L-tyrosine decarboxylase MfnA (EC 4.1.1.25) (NP_247014.1) from METHANOCOCCUS JANNASCHII at 2.11 A resolution
18	PDB:5hsjA	0.691	0.572	9.398E-20	606	0.203	0.165	5hsjA.pdb.gz	Crystal structure of tyrosine decarboxylase and identification of key residues involved in conformational swing and substrate binding
19	PDB:7cx0B	0.711	0.590	1.210E-19	603	0.181	0.148	7cx0B.pdb.gz	Crystal structure of a tyrosine decarboxylase from Enterococcus faecalis in complex with the cofactor PLP and inhibitor carbidopa
20	PDB:3hbxA	0.677	0.757	1.541E-15	437	0.124	0.140	3hbxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QPB1	0.0	534	566	0.509	0.443	A0A2R8QPB1_DANRE Glutamate decarboxylase 1 isoform X2 OS=Danio rerio OX=7955 GN=GAD67 PE=1 SV=1
2	F1QG14	0.0	698	544	0.625	0.566	F1QG14_DANRE Cysteine sulfinic acid decarboxylase OS=Danio rerio OX=7955 GN=zgc:103478 PE=1 SV=1
3	F1R9E8	0.0	538	583	0.515	0.436	F1R9E8_DANRE Glutamate decarboxylase 2 OS=Danio rerio OX=7955 GN=GAD65 PE=1 SV=1
4	P18088	0.0	539	593	0.519	0.432	DCE1_RAT Glutamate decarboxylase 1 OS=Rattus norvegicus OX=10116 GN=Gad1 PE=1 SV=1
5	P48318	0.0	537	593	0.519	0.432	DCE1_MOUSE Glutamate decarboxylase 1 OS=Mus musculus OX=10090 GN=Gad1 PE=1 SV=2
6	P48320	0.0	541	585	0.519	0.438	DCE2_MOUSE Glutamate decarboxylase 2 OS=Mus musculus OX=10090 GN=Gad2 PE=1 SV=1
7	Q05329	0.0	541	585	0.515	0.434	DCE2_HUMAN Glutamate decarboxylase 2 OS=Homo sapiens OX=9606 GN=GAD2 PE=1 SV=1
8	Q05683	0.0	541	585	0.519	0.438	DCE2_RAT Glutamate decarboxylase 2 OS=Rattus norvegicus OX=10116 GN=Gad2 PE=1 SV=1
9	Q24062	0.0	554	575	0.521	0.447	Q24062_DROME Black, isoform A OS=Drosophila melanogaster OX=7227 GN=b PE=1 SV=1
10	Q5U3I6	0.0	697	482	0.625	0.639	Q5U3I6_DANRE Csad protein OS=Danio rerio OX=7955 GN=zgc:103478 PE=1 SV=1
11	Q64611	0.0	927	493	0.897	0.897	CSAD_RAT Cysteine sulfinic acid decarboxylase OS=Rattus norvegicus OX=10116 GN=Csad PE=1 SV=1
12	Q6ZQY3	0.0	646	521	0.592	0.560	GADL1_HUMAN Acidic amino acid decarboxylase GADL1 OS=Homo sapiens OX=9606 GN=GADL1 PE=1 SV=4
13	Q7ZUS3	0.0	533	587	0.509	0.428	Q7ZUS3_DANRE GAD67 OS=Danio rerio OX=7955 GN=GAD67 PE=1 SV=1
14	Q8IVA8	0.0	538	594	0.521	0.433	Q8IVA8_HUMAN Glutamate decarboxylase 1 (Brain, 67kDa) OS=Homo sapiens OX=9606 GN=GAD1 PE=1 SV=1
15	Q99259	0.0	544	594	0.525	0.436	DCE1_HUMAN Glutamate decarboxylase 1 OS=Homo sapiens OX=9606 GN=GAD1 PE=1 SV=1
16	Q9DBE0	0.0	909	493	0.897	0.897	CSAD_MOUSE Cysteine sulfinic acid decarboxylase OS=Mus musculus OX=10090 GN=Csad PE=1 SV=1
17	X2J8B3	0.0	552	514	0.521	0.500	X2J8B3_DROME Black, isoform C OS=Drosophila melanogaster OX=7227 GN=b PE=1 SV=1
18	P20228	1.21e-168	487	510	0.471	0.455	DCE_DROME Glutamate decarboxylase OS=Drosophila melanogaster OX=7227 GN=Gad1 PE=1 SV=2
19	G5EDB7	3.62e-168	486	508	0.469	0.455	G5EDB7_CAEEL Glutamate decarboxylase 1 OS=Caenorhabditis elegans OX=6239 GN=unc-25 PE=1 SV=1
20	Q8I4D9	5.31e-160	462	433	0.434	0.494	Q8I4D9_CAEEL Glutamate decarboxylase OS=Caenorhabditis elegans OX=6239 GN=unc-25 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00266 Aminotran_5	0.17	22.4	Aminotransferase class-V
2	PF01212 Beta_elim_lyase	0.63	20.9	Beta-eliminating lyase
3	PF01041 DegT_DnrJ_EryC1	8.2e+02	10.6	DegT/DnrJ/EryC1/StrS aminotransferase family
4	PF00282 Pyridoxal_deC	2.7e-107	370.4	Pyridoxal-dependent decarboxylase conserved domain
5	PF05889 SepSecS	3.1e+02	11.4	O-phosphoseryl-tRNA(Sec) selenium transferase, SepSecS

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267085

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362888	0.968	2-aminoethanethiol dioxygenase
2	9606.ENSP00000250535	0.962	Cysteine dioxygenase type 1
3	9606.ENSP00000259407	0.916	Bile acid-CoA:amino acid N-acyltransferase
4	9606.ENSP00000370962	0.912	Glutathione hydrolase 6
5	9606.ENSP00000381340	0.911	Glutathione hydrolase 5 proenzyme
6	9606.ENSP00000338964	0.905	Glutathione hydrolase 7
7	9606.ENSP00000383232	0.905	Glutathione hydrolase 1 proenzyme
8	9606.ENSP00000365437	0.858	Glutamate decarboxylase 2
9	9606.ENSP00000359539	0.848	Aspartate aminotransferase, cytoplasmic
10	9606.ENSP00000245206	0.842	Aspartate aminotransferase, mitochondrial
11	9606.ENSP00000303077	0.807	Putative aspartate aminotransferase, cytoplasmic 2
12	9606.ENSP00000350928	0.807	Glutamate decarboxylase 1
13	9606.ENSP00000282538	0.804	Acidic amino acid decarboxylase GADL1
14	9606.ENSP00000217420	0.798	Vesicular inhibitory amino acid transporter
15	9606.ENSP00000480890	0.754	Sodium- and chloride-dependent taurine transporter
16	9606.ENSP00000229266	0.695	Cholinephosphotransferase 1
17	9606.ENSP00000365938	0.680	UDP-glucose:glycoprotein glucosyltransferase 2
18	9606.ENSP00000376458	0.662	Cell adhesion molecule-related/down-regulated by oncogenes
19	9606.ENSP00000320337	0.638	HRAS-like suppressor 3
20	9606.ENSP00000450337	0.626	Liprin-alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016831	1.000	carboxy-lyase activity
GO:0005488	0.955	binding
GO:0005515	0.933	protein binding
GO:0097159	0.433	organic cyclic compound binding
GO:1901363	0.416	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:1901565	0.995	organonitrogen compound catabolic process
GO:0006790	0.990	sulfur compound metabolic process
GO:0016054	0.990	organic acid catabolic process
GO:1901605	0.988	alpha-amino acid metabolic process
GO:0042219	0.979	cellular modified amino acid catabolic process
GO:1901606	0.973	alpha-amino acid catabolic process
GO:0009063	0.963	amino acid catabolic process
GO:0044273	0.954	sulfur compound catabolic process
GO:0009069	0.943	serine family amino acid metabolic process
GO:0009058	0.932	biosynthetic process
GO:0044272	0.922	sulfur compound biosynthetic process
GO:0016053	0.922	organic acid biosynthetic process
GO:0000096	0.886	sulfur amino acid metabolic process
GO:1901566	0.877	organonitrogen compound biosynthetic process
GO:0006534	0.510	cysteine metabolic process
GO:0009071	0.434	serine family amino acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.979	cytosol
GO:0043226	0.959	organelle
GO:0043227	0.949	membrane-bounded organelle
GO:0043229	0.787	intracellular organelle
GO:0031982	0.756	vesicle
GO:0043231	0.709	intracellular membrane-bounded organelle
GO:0097708	0.591	intracellular vesicle
GO:0031410	0.584	cytoplasmic vesicle
GO:0016020	0.527	membrane
GO:0012505	0.452	endomembrane system
GO:0030054	0.443	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.1.1.-	1.000	Carboxy-lyases.

[back to server]