StarFunc result for job id Q9Y608

User Input

>input (721 residues)
MGTPASGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRMRELERQQKEY
SLHSFDRKWGQIQKWLEDSERARYSHRSSHHRPYLGVEDALSIRSVGSHRYDMFKDRSSR
LSSLNHSYSHSHGMKKRSSDSHKDLLSGLYFDQRNYSSLRHSKPTSAYYTRQSSSLYSDP
LATYKSDRASPTANSGLLRSASLASLYNGGLYNPYGPRTPSECSYYSSRISSARSSPGFT
NDDTASIVSSDRASRGRRESVVSAADYFSRSNRRGSVVSEVDDISIPDLSSLDEKSDKQY
AENYTRPSSRNSASATTPLSGNSSRRGSGDTSSLIDPDTSLSELRDIYDLKDQIQDVEGR
YMQGLKELKESLSEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDVIEEQEEQMAEFYRE
NEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELIEEKQRMQQKIDTMTKEVFDLQETL
LWKDKKIGALEKQKEYIACLRNERDMLREELADLQETVKTGEKHGLVIIPDGTPNGDVSH
EPVAGAITVVSQEAAQVLESAGEGPLDVRLRKLAGEKEELLSQIRKLKLQLEEERQKCSR
NDGTVGDLAGLQNGSDLQFIEMQRDANRQISEYKFKLSKAEQDITTLEQSISRLEGQVLR
YKTAAENAEKVEDELKAEKRKLQRELRTALDKIEEMEMTNSHLAKRLEKMKANRTALLAQ
Q

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y608	1.000	1.000	1.306E-99	721	1.000	1.000	Q9Y608.pdb.gz	LRRF2_HUMAN Leucine-rich repeat flightless-interacting protein 2 OS=Homo sapiens OX=9606 GN=LRRFIP2 PE=1 SV=1
2	AFDB:Q6GNW0	0.326	0.323	1.334E-64	729	0.717	0.709	Q6GNW0.pdb.gz	LRRF2_XENLA Leucine-rich repeat flightless-interacting protein 2 OS=Xenopus laevis OX=8355 GN=lrrfip2 PE=2 SV=2
3	AFDB:A0A2R8Y7M0	0.150	0.114	4.436E-6	985	0.160	0.117	A0A2R8Y7M0.pdb.gz	A0A2R8Y7M0_HUMAN TATA element modulatory factor 1 OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=1
4	AFDB:P59242	0.104	0.068	1.007E-5	1191	0.190	0.115	P59242.pdb.gz	CING_MOUSE Cingulin OS=Mus musculus OX=10090 GN=Cgn PE=1 SV=1
5	AFDB:Q4GZA8	0.156	0.127	1.085E-5	970	0.150	0.111	Q4GZA8.pdb.gz	Q4GZA8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1100 PE=4 SV=1
6	AFDB:B8A6E8	0.154	0.151	1.170E-5	741	0.165	0.161	B8A6E8.pdb.gz	B8A6E8_DANRE Leucine zipper putative tumor suppressor 2 homolog OS=Danio rerio OX=7955 GN=lzts2 PE=1 SV=1
7	AFDB:Q8BI79	0.142	0.097	1.260E-5	1192	0.160	0.096	Q8BI79.pdb.gz	CCD40_MOUSE Coiled-coil domain-containing protein 40 OS=Mus musculus OX=10090 GN=Ccdc40 PE=1 SV=1
8	AFDB:Q9QYE6	0.131	0.130	1.698E-5	729	0.151	0.150	Q9QYE6.pdb.gz	GOGA5_MOUSE Golgin subfamily A member 5 OS=Mus musculus OX=10090 GN=Golga5 PE=1 SV=2
9	AFDB:Q9UPV0	0.194	0.108	1.829E-5	1460	0.160	0.079	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
10	AFDB:Q08581	0.194	0.174	1.971E-5	821	0.147	0.129	Q08581.pdb.gz	SLK19_YEAST Kinetochore protein SLK19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLK19 PE=1 SV=1
11	PDB:7mqaNA	0.044	0.097	4.130	295	0.035	0.085	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7v2wJ	0.053	0.134	4.450	236	0.019	0.059	7v2wJ.pdb.gz
13	PDB:1dlmA	0.043	0.088	4.794	309	0.018	0.042	1dlmA.pdb.gz	The 1.8 A crystal structure of catechol 1,2-dioxygenase reveals a novel hydrophobic helical zipper as a subunit linker.
14	PDB:1no4A	0.077	0.495	5.165	77	0.011	0.104	1no4A.pdb.gz
15	PDB:6wgf4	0.029	0.032	5.565	636	0.012	0.014	6wgf4.pdb.gz
16	PDB:6fvtU	0.066	0.143	6.960	304	0.031	0.072	6fvtU.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
17	PDB:6kytC	0.040	0.262	6.960	73	0.019	0.192	6kytC.pdb.gz
18	PDB:6qm5A	0.031	0.033	6.960	673	0.022	0.024	6qm5A.pdb.gz	Stepwise activation mechanism of the scramblase nhTMEM16 revealed by cryo-EM.
19	PDB:6a6xC	0.068	0.491	8.080	75	0.022	0.213	6a6xC.pdb.gz
20	PDB:6n7pA	0.050	0.149	8.080	186	0.024	0.091	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6GNW0	0.0	929	729	0.725	0.717	LRRF2_XENLA Leucine-rich repeat flightless-interacting protein 2 OS=Xenopus laevis OX=8355 GN=lrrfip2 PE=2 SV=2
2	Q9Y608	0.0	1471	721	1.000	1.000	LRRF2_HUMAN Leucine-rich repeat flightless-interacting protein 2 OS=Homo sapiens OX=9606 GN=LRRFIP2 PE=1 SV=1
3	Q91WK0	4.30e-131	396	415	0.293	0.508	LRRF2_MOUSE Leucine-rich repeat flightless-interacting protein 2 OS=Mus musculus OX=10090 GN=Lrrfip2 PE=1 SV=1
4	Q32MZ4	1.40e-46	179	808	0.136	0.121	LRRF1_HUMAN Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2
5	Q9VXN3	1.32e-31	129	396	0.186	0.338	Q9VXN3_DROME LD07988p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8578 PE=1 SV=2
6	Q3UZ39	1.96e-31	133	729	0.115	0.114	LRRF1_MOUSE Leucine-rich repeat flightless-interacting protein 1 OS=Mus musculus OX=10090 GN=Lrrfip1 PE=1 SV=2
7	A0A0F7NGI8	8.24e-30	128	752	0.112	0.108	A0A0F7NGI8_HUMAN Leucine rich repeat (In FLII) interacting protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=2 SV=1
8	Q6X1Y7	0.099	38.5	1294	0.043	0.024	Q6X1Y7_LEGPN Effector protein B OS=Legionella pneumophila OX=446 GN=lepB PE=1 SV=1
9	Q86W92	0.17	37.7	1011	0.087	0.062	LIPB1_HUMAN Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2
10	Q580U6	0.21	37.4	944	0.060	0.046	Q580U6_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.440 PE=4 SV=1
11	Q8TDY2	0.31	37.0	1594	0.026	0.012	RBCC1_HUMAN RB1-inducible coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=RB1CC1 PE=1 SV=3
12	A0A1B0GWM3	0.32	37.0	3333	0.076	0.017	A0A1B0GWM3_RAT Laminin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Lama3 PE=4 SV=2
13	F4JGP4	0.76	35.4	790	0.065	0.059	KN14D_ARATH Kinesin-like protein KIN-14D OS=Arabidopsis thaliana OX=3702 GN=KIN14D PE=2 SV=1
14	Q57WE8	1.0	35.4	4334	0.050	0.008	Q57WE8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.760 PE=4 SV=1
15	H2L0I4	1.2	35.0	2392	0.050	0.015	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
16	H2L0I2	1.3	35.0	2396	0.050	0.015	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
17	H2L0I3	1.3	35.0	2323	0.050	0.015	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
18	P78559	1.7	34.7	2803	0.065	0.017	MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo sapiens OX=9606 GN=MAP1A PE=1 SV=6
19	E9PFQ4	2.4	33.9	1115	0.047	0.030	E9PFQ4_HUMAN Pleckstrin homology like domain family B member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
20	Q60979	2.8	33.9	674	0.087	0.093	Q60979_MOUSE SnoN protein OS=Mus musculus OX=10090 GN=Skil PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09738 LRRFIP	3.6e-95	330.4	LRRFIP family
2	PF16038 TMIE	2.1e+02	13.1	TMIE protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324573	0.971	Protein flightless-1 homolog
2	9606.ENSP00000401399	0.790	Myeloid differentiation primary response protein MyD88
3	9606.ENSP00000316054	0.785	Segment polarity protein dishevelled homolog DVL-3
4	9606.ENSP00000306253	0.735	Inositol 1,4,5-trisphosphate receptor type 1
5	9606.ENSP00000337383	0.657	NACHT, LRR and PYD domains-containing protein 3
6	9606.ENSP00000385787	0.651	Ribonucleases P/MRP protein subunit POP1
7	9606.ENSP00000238823	0.643	Protein FAM98A
8	9606.ENSP00000470152	0.626	Dystrobrevin alpha
9	9606.ENSP00000222792	0.607	Beta-chimaerin
10	9606.ENSP00000368959	0.590	Receptor expression-enhancing protein 5
11	9606.ENSP00000314556	0.557	Uveal autoantigen with coiled-coil domains and ankyrin repeats
12	9606.ENSP00000384763	0.551	Sodium/calcium exchanger 1
13	9606.ENSP00000185150	0.549	Endoplasmic reticulum lectin 1
14	9606.ENSP00000259365	0.529	Tropomodulin-1
15	9606.ENSP00000376317	0.525	Serine/threonine-protein kinase TAO3
16	9606.ENSP00000295951	0.524	Sarcolemmal membrane-associated protein
17	9606.ENSP00000380336	0.524	WD40 repeat-containing protein SMU1
18	9606.ENSP00000433352	0.523	LIM domain only protein 7
19	9606.ENSP00000351108	0.516	Heterogeneous nuclear ribonucleoprotein A/B
20	9606.ENSP00000368169	0.514	Segment polarity protein dishevelled homolog DVL-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030275	1.000	LRR domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007165	0.989	signal transduction
GO:0032502	0.957	developmental process
GO:0007166	0.949	cell surface receptor signaling pathway
GO:0048856	0.932	anatomical structure development
GO:0007267	0.922	cell-cell signaling
GO:0032501	0.900	multicellular organismal process
GO:0003002	0.765	regionalization
GO:0009953	0.747	dorsal/ventral pattern formation
GO:0198738	0.722	cell-cell signaling by wnt
GO:1905114	0.721	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0009798	0.706	axis specification
GO:0019222	0.515	regulation of metabolic process
GO:0060255	0.505	regulation of macromolecule metabolic process
GO:0080090	0.491	regulation of primary metabolic process
GO:0051171	0.491	regulation of nitrogen compound metabolic process
GO:0031323	0.491	regulation of cellular metabolic process
GO:0016055	0.332	Wnt signaling pathway
GO:0010468	0.315	regulation of gene expression
GO:0009950	0.314	dorsal/ventral axis specification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043226	0.994	organelle
GO:0071944	0.979	cell periphery
GO:0043229	0.976	intracellular organelle
GO:0043232	0.972	intracellular non-membrane-bounded organelle
GO:0016020	0.910	membrane
GO:0043227	0.883	membrane-bounded organelle
GO:0005829	0.875	cytosol
GO:0005856	0.871	cytoskeleton
GO:0043231	0.844	intracellular membrane-bounded organelle
GO:0005886	0.768	plasma membrane
GO:0005634	0.562	nucleus
GO:0005654	0.418	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]