StarFunc result for job id Q9Y613

User Input

>input (1164 residues)
MAGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHR
LLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRV
NAILEKLYSSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYI
LRALGQLMLFVDGMLGVVAHSDTIQWLYTLCASLSRLVVKTALKLLLVFVEYSENNAPLF
IRAVNSVASTTGAPPWANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDSFYDVTDA
LEQQGMEALVQRHLGTAGTDVDLRTQLVLYENALKLEDGDIEEAPGAGGRRERRKPSSEE
GKRSRRSLEGGGCPARAPEPGPTGPASPVGPTSSTGPALLTGPASSPVGPPSGLQASVNL
FPTISVAPSADTSSERSIYKARFLENVAAAETEKQVALAQGRAETLAGAMPNEAGGHPDA
RQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLS
IGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVPPPPPLPPPPPIKGPFPP
PPPLPLAAPLPHSVPDSSALPTKRKTVKLFWRELKLAGGHGVSASRFGPCATLWASLDPV
SVDTARLEHLFESRAKEVLPSKKAGEGRRTMTTVLDPKRSNAINIGLTTLPPVHVIKAAL
LNFDEFAVSKDGIEKLLTMMPTEEERQKIEEAQLANPDIPLGPAENFLMTLASIGGLAAR
LQLWAFKLDYDSMEREIAEPLFDLKVGMEQLVQNATFRCILATLLAVGNFLNGSQSSGFE
LSYLEKVSEVKDTVRRQSLLHHLCSLVLQTRPESSDLYSEIPALTRCAKVDFEQLTENLG
QLERRSRAAEESLRSLAKHELAPALRARLTHFLDQCARRVAMLRIVHRRVCNRFHAFLLY
LGYTPQAAREVRIMQFCHTLREFALEYRTCRERVLQQQQKQATYRERNKTRGRMITETEK
FSGVAGEAPSNPSVPVAVSSGPGRGDADSHASMKSLLTSRPEDTTHNRRSRGMVQSSSPI
MPTVGPSTASPEEPPGSSLPSDTSDEIMDLLVQSVTKSSPRALAARERKRSRGNRKSLRR
TLKSGLGDDLVQALGLSKGPGLEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P9Q4	0.395	0.385	0.000	1197	0.878	0.854	Q6P9Q4.pdb.gz	FHOD1_MOUSE FH1/FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhod1 PE=1 SV=3
2	AFDB:Q9Y613	1.000	1.000	0.000	1164	1.000	1.000	Q9Y613.pdb.gz	FHOD1_HUMAN FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3
3	AFDB:Q2V2M9	0.380	0.316	1.913E-73	1422	0.511	0.418	Q2V2M9.pdb.gz	FHOD3_HUMAN FH1/FH2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FHOD3 PE=1 SV=2
4	AFDB:F1LQJ2	0.369	0.278	5.808E-71	1578	0.521	0.385	F1LQJ2.pdb.gz	F1LQJ2_RAT Formin homology 2 domain containing 3 OS=Rattus norvegicus OX=10116 GN=Fhod3 PE=4 SV=4
5	AFDB:M9NFP9	0.302	0.305	3.511E-63	1152	0.435	0.439	M9NFP9.pdb.gz	M9NFP9_DROME Formin homology 2 domain containing, isoform G OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
6	AFDB:Q9SE97	0.248	0.274	4.145E-12	1051	0.131	0.146	Q9SE97.pdb.gz	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1
7	AFDB:Q94B77	0.225	0.287	4.681E-12	900	0.160	0.207	Q94B77.pdb.gz	FH5_ARATH Formin-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=FH5 PE=2 SV=2
8	AFDB:Q9FJX6	0.248	0.318	4.681E-12	899	0.137	0.178	Q9FJX6.pdb.gz	FH6_ARATH Formin-like protein 6 OS=Arabidopsis thaliana OX=3702 GN=FH6 PE=2 SV=1
9	AFDB:Q8GX37	0.242	0.352	1.741E-9	782	0.109	0.162	Q8GX37.pdb.gz	FH9_ARATH Formin-like protein 9 OS=Arabidopsis thaliana OX=3702 GN=FH9 PE=2 SV=2
10	PDB:6tgbB	0.175	0.271	1.752E-4	680	0.056	0.096	6tgbB.pdb.gz
11	AFDB:Q961B0	0.153	0.166	6.162E-3	1067	0.064	0.069	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
12	PDB:7rroH7	0.143	0.272	1.709E-2	580	0.027	0.055	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:7cm7A	0.110	0.198	1.930E-2	620	0.034	0.065	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
14	PDB:2z6gA	0.147	0.294	2.364E-2	550	0.026	0.055	2z6gA.pdb.gz
15	PDB:7rbsB	0.057	0.337	2.364E-2	157	0.014	0.102	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
16	PDB:5tbkA	0.141	0.321	2.670E-2	417	0.025	0.070	5tbkA.pdb.gz
17	PDB:6kbnC	0.135	0.267	2.780E-2	504	0.032	0.073	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
18	PDB:4tnmA	0.127	0.300	2.895E-2	407	0.032	0.091	4tnmA.pdb.gz
19	PDB:7np7D4	0.064	0.150	3.269E-2	415	0.052	0.147	7np7D4.pdb.gz
20	PDB:1b3uA	0.108	0.183	3.405E-2	588	0.025	0.049	1b3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LQJ2	0.0	590	1578	0.265	0.195	F1LQJ2_RAT Formin homology 2 domain containing 3 OS=Rattus norvegicus OX=10116 GN=Fhod3 PE=4 SV=4
2	M9NFP9	0.0	805	1152	0.436	0.441	M9NFP9_DROME Formin homology 2 domain containing, isoform G OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
3	Q2V2M9	0.0	595	1422	0.291	0.238	FHOD3_HUMAN FH1/FH2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FHOD3 PE=1 SV=2
4	Q6P9Q4	0.0	1025	1197	0.434	0.422	FHOD1_MOUSE FH1/FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhod1 PE=1 SV=3
5	Q76LL6	0.0	590	1578	0.265	0.195	FHOD3_MOUSE FH1/FH2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fhod3 PE=1 SV=1
6	Q9Y613	0.0	2352	1164	1.000	1.000	FHOD1_HUMAN FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3
7	Q8T4F5	8.77e-144	466	1211	0.223	0.214	Q8T4F5_DROME SD08909p OS=Drosophila melanogaster OX=7227 GN=Fhos PE=2 SV=1
8	Q9VSQ1	2.65e-142	467	1393	0.223	0.186	Q9VSQ1_DROME Formin homology 2 domain containing, isoform A OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
9	M9ND66	5.29e-140	466	1744	0.223	0.149	M9ND66_DROME Formin homology 2 domain containing, isoform H OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
10	M9NE63	1.04e-139	456	1205	0.216	0.209	M9NE63_DROME Formin homology 2 domain containing, isoform F OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
11	E1JI78	1.37e-138	468	2528	0.223	0.102	E1JI78_DROME Formin homology 2 domain containing, isoform I OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
12	M9MRS9	3.86e-138	455	1387	0.216	0.182	M9MRS9_DROME Formin homology 2 domain containing, isoform E OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
13	M9MSK7	1.05e-135	451	1509	0.216	0.166	M9MSK7_DROME Formin homology 2 domain containing, isoform D OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
14	Q8SY43	1.77e-133	441	1294	0.186	0.168	Q8SY43_DROME LD24110p OS=Drosophila melanogaster OX=7227 GN=Fhos PE=2 SV=1
15	Q9VSQ0	1.77e-133	441	1294	0.186	0.168	Q9VSQ0_DROME FI03664p OS=Drosophila melanogaster OX=7227 GN=Fhos PE=2 SV=2
16	A0A0K3AU72	2.93e-88	316	1698	0.162	0.111	A0A0K3AU72_CAEEL Formin HOmology Domain OS=Caenorhabditis elegans OX=6239 GN=fhod-1 PE=1 SV=1
17	Q1ZXK2	1.43e-25	117	1074	0.076	0.083	FORG_DICDI Formin-G OS=Dictyostelium discoideum OX=44689 GN=forG PE=1 SV=1
18	Q9C6S1	5.71e-22	105	1230	0.070	0.066	FH14_ARATH Formin-like protein 14 OS=Arabidopsis thaliana OX=3702 GN=FH14 PE=3 SV=3
19	P48608	7.71e-19	95.1	1091	0.062	0.066	DIA_DROME Protein diaphanous OS=Drosophila melanogaster OX=7227 GN=dia PE=2 SV=2
20	Q24120	8.11e-19	95.1	1059	0.067	0.074	CAPU_DROME Protein cappuccino OS=Drosophila melanogaster OX=7227 GN=capu PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02181 FH2	1.1e-87	306.3	Formin Homology 2 Domain
2	PF18382 Formin_GBD_N	3.8e-41	151.5	Formin N-terminal GTPase-binding domain
3	PF07527 Hairy_orange	66	15.2	Hairy Orange

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258201

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350719	0.931	Nesprin-2
2	9606.ENSP00000317985	0.867	Rho-associated protein kinase 2
3	9606.ENSP00000451828	0.831	RAC-alpha serine/threonine-protein kinase
4	9606.ENSP00000383118	0.777	Cell division control protein 42 homolog
5	9606.ENSP00000348461	0.768	Ras-related C3 botulinum toxin substrate 1
6	9606.ENSP00000407586	0.733	GTPase HRas
7	9606.ENSP00000356024	0.717	Complement receptor type 2
8	9606.ENSP00000263212	0.678	Protein phosphatase 1F
9	9606.ENSP00000355361	0.647	Leukocyte surface antigen CD47
10	9606.ENSP00000357206	0.647	Nestin
11	9606.ENSP00000352071	0.640	Scavenger receptor cysteine-rich type 1 protein M130
12	9606.ENSP00000356016	0.637	Complement receptor type 1
13	9606.ENSP00000297265	0.613	Charged multivesicular body protein 4c
14	9606.ENSP00000303208	0.594	Proprotein convertase subtilisin/kexin type 9
15	9606.ENSP00000225655	0.561	Profilin-1
16	9606.ENSP00000239940	0.561	Profilin-2
17	9606.ENSP00000310036	0.553	Hematopoietic progenitor cell antigen CD34
18	9606.ENSP00000458162	0.550	Actin, cytoplasmic 2
19	9606.ENSP00000329219	0.548	Formin-like protein 1
20	9606.ENSP00000323280	0.545	T-cell differentiation antigen CD6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043621	1.000	protein self-association
GO:0019904	1.000	protein domain specific binding
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032956	0.995	regulation of actin cytoskeleton organization
GO:0110053	0.994	regulation of actin filament organization
GO:0044087	0.989	regulation of cellular component biogenesis
GO:0048522	0.989	positive regulation of cellular process
GO:0051130	0.982	positive regulation of cellular component organization
GO:0044089	0.975	positive regulation of cellular component biogenesis
GO:0110020	0.947	regulation of actomyosin structure organization
GO:0019222	0.946	regulation of metabolic process
GO:0032231	0.946	regulation of actin filament bundle assembly
GO:0009987	0.942	cellular process
GO:0051495	0.940	positive regulation of cytoskeleton organization
GO:1902905	0.938	positive regulation of supramolecular fiber organization
GO:0051492	0.910	regulation of stress fiber assembly
GO:0032233	0.894	positive regulation of actin filament bundle assembly
GO:0051171	0.890	regulation of nitrogen compound metabolic process
GO:0080090	0.889	regulation of primary metabolic process
GO:0031323	0.889	regulation of cellular metabolic process
GO:0010604	0.883	positive regulation of macromolecule metabolic process
GO:0051496	0.799	positive regulation of stress fiber assembly
GO:0010468	0.793	regulation of gene expression
GO:0031325	0.778	positive regulation of cellular metabolic process
GO:0051173	0.658	positive regulation of nitrogen compound metabolic process
GO:0019219	0.614	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.444	regulation of cellular biosynthetic process
GO:0050896	0.425	response to stimulus
GO:0071840	0.407	cellular component organization or biogenesis
GO:0016043	0.404	cellular component organization
GO:0051179	0.386	localization
GO:0051252	0.371	regulation of RNA metabolic process
GO:0010556	0.367	regulation of macromolecule biosynthetic process
GO:0006355	0.349	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.998	nucleus
GO:0016020	0.994	membrane
GO:0031981	0.992	nuclear lumen
GO:0005829	0.991	cytosol
GO:0043232	0.982	intracellular non-membrane-bounded organelle
GO:0005654	0.980	nucleoplasm
GO:0071944	0.933	cell periphery
GO:0030054	0.920	cell junction
GO:0005886	0.915	plasma membrane
GO:0005856	0.906	cytoskeleton
GO:0031982	0.870	vesicle
GO:0070161	0.828	anchoring junction
GO:0015629	0.800	actin cytoskeleton
GO:0042641	0.522	actomyosin
GO:0032432	0.450	actin filament bundle
GO:0097517	0.411	contractile actin filament bundle
GO:0001725	0.399	stress fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]