StarFunc result for job id Q9Y616

User Input

>input (596 residues)
MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEK
YVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGG
FPNILFKETANVTVDNVLIPEHNEKGILLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVY
RVEIQNLTYAVKLFKQEKKMQCKKHWKRFLSELEVLLLFHHPNILELAAYFTETEKFCLI
YPYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHYLHNVQPCSVICGSISSANIL
LDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGKLSIKTDVYSF
GIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC
LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVE
DDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCE
ESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y616	1.000	1.000	2.626E-101	596	1.000	1.000	Q9Y616.pdb.gz	IRAK3_HUMAN Interleukin-1 receptor-associated kinase 3 OS=Homo sapiens OX=9606 GN=IRAK3 PE=1 SV=2
2	AFDB:Q8K4B2	0.721	0.706	1.447E-82	609	0.762	0.745	Q8K4B2.pdb.gz	IRAK3_MOUSE Interleukin-1 receptor-associated kinase 3 OS=Mus musculus OX=10090 GN=Irak3 PE=1 SV=2
3	AFDB:B0UYS2	0.537	0.510	2.406E-49	630	0.398	0.376	B0UYS2.pdb.gz	B0UYS2_DANRE Interleukin-1 receptor-associated kinase 3 OS=Danio rerio OX=7955 GN=irak3 PE=4 SV=1
4	AFDB:Q99J34	0.469	0.394	2.871E-31	717	0.282	0.234	Q99J34.pdb.gz	Q99J34_MOUSE Irak1 protein OS=Mus musculus OX=10090 GN=Irak1 PE=1 SV=1
5	AFDB:G5ECP4	0.460	0.561	1.918E-30	485	0.205	0.252	G5ECP4.pdb.gz	PIK1_CAEEL Pelle-like serine/threonine-protein kinase pik-1 OS=Caenorhabditis elegans OX=6239 GN=pik-1 PE=1 SV=1
6	AFDB:Q6IWL3	0.457	0.560	3.035E-28	483	0.191	0.236	Q6IWL3.pdb.gz
7	AFDB:F4KAX4	0.468	0.297	1.534E-25	951	0.178	0.111	F4KAX4.pdb.gz	F4KAX4_ARATH Leucine-rich repeat protein kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g01950 PE=1 SV=1
8	AFDB:Q1PDV6	0.470	0.542	1.617E-25	513	0.181	0.211	Q1PDV6.pdb.gz	PBL27_ARATH Serine/threonine-protein kinase PBL27 OS=Arabidopsis thaliana OX=3702 GN=PBL27 PE=1 SV=1
9	AFDB:Q9FID9	0.468	0.321	2.465E-25	880	0.181	0.123	Q9FID9.pdb.gz	Y5389_ARATH Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana OX=3702 GN=At5g38990 PE=2 SV=1
10	AFDB:Q9SIT1	0.465	0.297	2.599E-25	943	0.174	0.110	Q9SIT1.pdb.gz	TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana OX=3702 GN=TMK3 PE=1 SV=1
11	PDB:8dksA	0.428	0.870	4.488E-22	283	0.149	0.314	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
12	PDB:2qkwB	0.424	0.844	1.204E-19	292	0.151	0.308	2qkwB.pdb.gz
13	PDB:6j5tH	0.444	0.777	1.012E-17	327	0.126	0.229	6j5tH.pdb.gz	Reconstitution and structure of a plant NLR resistosome conferring immunity.
14	PDB:5tosA	0.403	0.827	1.906E-17	280	0.138	0.293	5tosA.pdb.gz
15	PDB:6j5wB	0.414	0.776	3.534E-15	306	0.121	0.235	6j5wB.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
16	PDB:6lk5A	0.346	0.737	2.164E-13	265	0.107	0.242	6lk5A.pdb.gz
17	PDB:1k9aB	0.352	0.468	5.896E-13	441	0.102	0.138	1k9aB.pdb.gz
18	PDB:5u6yA	0.332	0.422	3.362E-12	459	0.102	0.133	5u6yA.pdb.gz
19	PDB:4btfA	0.312	0.432	4.152E-12	413	0.144	0.208	4btfA.pdb.gz
20	PDB:6xr4A	0.345	0.205	5.698E-12	1040	0.109	0.062	6xr4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K4B2	0.0	944	609	0.762	0.745	IRAK3_MOUSE Interleukin-1 receptor-associated kinase 3 OS=Mus musculus OX=10090 GN=Irak3 PE=1 SV=2
2	Q9Y616	0.0	1239	596	1.000	1.000	IRAK3_HUMAN Interleukin-1 receptor-associated kinase 3 OS=Homo sapiens OX=9606 GN=IRAK3 PE=1 SV=2
3	B0UYS2	1.17e-131	400	630	0.378	0.357	B0UYS2_DANRE Interleukin-1 receptor-associated kinase 3 OS=Danio rerio OX=7955 GN=irak3 PE=4 SV=1
4	B2RYH5	3.15e-60	214	710	0.270	0.227	B2RYH5_RAT Interleukin-1 receptor-associated kinase 1 (Predicted) OS=Rattus norvegicus OX=10116 GN=Irak1 PE=2 SV=1
5	Q62406	3.28e-60	214	710	0.280	0.235	IRAK1_MOUSE Interleukin-1 receptor-associated kinase 1 OS=Mus musculus OX=10090 GN=Irak1 PE=1 SV=3
6	A0A0G2JYX9	3.71e-60	214	711	0.270	0.226	A0A0G2JYX9_RAT Interleukin-1 receptor-associated kinase 1 OS=Rattus norvegicus OX=10116 GN=Irak1 PE=1 SV=1
7	A0A8I6AR42	4.69e-60	214	709	0.270	0.227	A0A8I6AR42_RAT Interleukin-1 receptor-associated kinase 1 OS=Rattus norvegicus OX=10116 GN=Irak1 PE=1 SV=1
8	Q99J34	1.04e-54	199	717	0.201	0.167	Q99J34_MOUSE Irak1 protein OS=Mus musculus OX=10090 GN=Irak1 PE=1 SV=1
9	A0A8I5ZRN5	7.50e-54	196	631	0.225	0.212	A0A8I5ZRN5_RAT Interleukin-1 receptor-associated kinase 1 OS=Rattus norvegicus OX=10116 GN=Irak1 PE=1 SV=1
10	P51617	1.64e-53	196	712	0.262	0.219	IRAK1_HUMAN Interleukin-1 receptor-associated kinase 1 OS=Homo sapiens OX=9606 GN=IRAK1 PE=1 SV=2
11	A0A8I6G1H3	3.14e-44	166	461	0.215	0.278	A0A8I6G1H3_RAT Interleukin-1 receptor-associated kinase 4 OS=Rattus norvegicus OX=10116 GN=Irak4 PE=1 SV=1
12	D4A7K4	1.75e-42	160	455	0.208	0.273	D4A7K4_RAT Interleukin-1 receptor-associated kinase 4 OS=Rattus norvegicus OX=10116 GN=Irak4 PE=1 SV=2
13	Q69FE3	5.39e-42	159	460	0.213	0.276	Q69FE3_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens OX=9606 GN=IRAK4 PE=1 SV=1
14	Q9NWZ3	5.39e-42	159	460	0.213	0.276	IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens OX=9606 GN=IRAK4 PE=1 SV=1
15	Q8R4K2	1.25e-39	152	459	0.203	0.264	IRAK4_MOUSE Interleukin-1 receptor-associated kinase 4 OS=Mus musculus OX=10090 GN=Irak4 PE=1 SV=1
16	F4KAX4	3.66e-37	150	951	0.174	0.109	F4KAX4_ARATH Leucine-rich repeat protein kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g01950 PE=1 SV=1
17	O49840	1.46e-36	143	426	0.181	0.254	PBL3_ARATH Probable serine/threonine-protein kinase PBL3 OS=Arabidopsis thaliana OX=3702 GN=PBL3 PE=1 SV=1
18	Q0WRY5	1.66e-36	142	378	0.168	0.265	PBL7_ARATH Probable serine/threonine-protein kinase PBL7 OS=Arabidopsis thaliana OX=3702 GN=PBL7 PE=1 SV=1
19	G5ECP4	1.01e-35	142	485	0.153	0.188	PIK1_CAEEL Pelle-like serine/threonine-protein kinase pik-1 OS=Caenorhabditis elegans OX=6239 GN=pik-1 PE=1 SV=1
20	P46573	2.52e-35	139	412	0.171	0.248	PBL10_ARATH Probable serine/threonine-protein kinase PBL10 OS=Arabidopsis thaliana OX=3702 GN=PBL10 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	1.2e-10	52.7	Death domain
2	PF13095 FTA2	96	14.1	Kinetochore Sim4 complex subunit FTA2
3	PF00069 Pkinase	8.9e-31	118.8	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	2.9e-28	110.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261233

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401399	0.997	Myeloid differentiation primary response protein MyD88
2	9606.ENSP00000433623	0.997	TNF receptor-associated factor 6
3	9606.ENSP00000358997	0.984	Interleukin-1 receptor-associated kinase 1
4	9606.ENSP00000256458	0.977	Interleukin-1 receptor-associated kinase-like 2
5	9606.ENSP00000314733	0.975	Toll-interacting protein
6	9606.ENSP00000386380	0.960	Interleukin-1 receptor type 1
7	9606.ENSP00000390651	0.957	Interleukin-1 receptor-associated kinase 4
8	9606.ENSP00000263341	0.956	Interleukin-1 beta
9	9606.ENSP00000259206	0.936	Interleukin-1 receptor antagonist protein
10	9606.ENSP00000263339	0.932	Interleukin-1 alpha
11	9606.ENSP00000314807	0.923	Interleukin 1 receptor accessory protein
12	9606.ENSP00000172229	0.812	Tumor necrosis factor receptor superfamily member 16
13	9606.ENSP00000403104	0.764	Single Ig IL-1-related receptor
14	9606.ENSP00000260010	0.762	Toll-like receptor 2
15	9606.ENSP00000363089	0.748	Toll-like receptor 4
16	9606.ENSP00000332049	0.729	T-lymphocyte activation antigen CD86
17	9606.ENSP00000329418	0.686	Suppressor of cytokine signaling 1
18	9606.ENSP00000300589	0.623	Nucleotide-binding oligomerization domain-containing protein 2
19	9606.ENSP00000354932	0.619	Toll-like receptor 1
20	9606.ENSP00000398698	0.605	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005524	1.000	ATP binding
GO:0042803	0.998	protein homodimerization activity
GO:0000287	0.998	magnesium ion binding
GO:0019899	0.957	enzyme binding
GO:0019900	0.885	kinase binding
GO:0046982	0.858	protein heterodimerization activity
GO:0019901	0.646	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0023052	0.986	signaling
GO:0007154	0.986	cell communication
GO:0048583	0.986	regulation of response to stimulus
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0051716	0.980	cellular response to stimulus
GO:0009966	0.980	regulation of signal transduction
GO:0010033	0.979	response to organic substance
GO:0048518	0.977	positive regulation of biological process
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0007165	0.972	signal transduction
GO:0032101	0.963	regulation of response to external stimulus
GO:0048584	0.962	positive regulation of response to stimulus
GO:0065009	0.961	regulation of molecular function
GO:0010468	0.960	regulation of gene expression
GO:0051174	0.957	regulation of phosphorus metabolic process
GO:0051707	0.955	response to other organism
GO:0001959	0.950	regulation of cytokine-mediated signaling pathway
GO:0051091	0.949	positive regulation of DNA-binding transcription factor activity
GO:0002682	0.938	regulation of immune system process
GO:0071704	0.936	organic substance metabolic process
GO:0043549	0.936	regulation of kinase activity
GO:0051092	0.936	positive regulation of NF-kappaB transcription factor activity
GO:0070887	0.934	cellular response to chemical stimulus
GO:0045088	0.928	regulation of innate immune response
GO:0045859	0.924	regulation of protein kinase activity
GO:0043408	0.923	regulation of MAPK cascade
GO:0071310	0.911	cellular response to organic substance
GO:0001817	0.905	regulation of cytokine production
GO:0006807	0.897	nitrogen compound metabolic process
GO:0044238	0.892	primary metabolic process
GO:1901564	0.891	organonitrogen compound metabolic process
GO:0002757	0.890	immune response-activating signaling pathway
GO:0045089	0.886	positive regulation of innate immune response
GO:0019221	0.885	cytokine-mediated signaling pathway
GO:0044237	0.881	cellular metabolic process
GO:0043170	0.877	macromolecule metabolic process
GO:0043412	0.873	macromolecule modification
GO:0019538	0.873	protein metabolic process
GO:0009893	0.858	positive regulation of metabolic process
GO:0048522	0.838	positive regulation of cellular process
GO:0006468	0.830	protein phosphorylation
GO:0044092	0.805	negative regulation of molecular function
GO:0010604	0.803	positive regulation of macromolecule metabolic process
GO:0048519	0.785	negative regulation of biological process
GO:0051241	0.779	negative regulation of multicellular organismal process
GO:0048523	0.759	negative regulation of cellular process
GO:0009968	0.704	negative regulation of signal transduction
GO:0009892	0.697	negative regulation of metabolic process
GO:0010605	0.683	negative regulation of macromolecule metabolic process
GO:0071900	0.677	regulation of protein serine/threonine kinase activity
GO:0032680	0.671	regulation of tumor necrosis factor production
GO:0031324	0.666	negative regulation of cellular metabolic process
GO:0043405	0.633	regulation of MAP kinase activity
GO:0051172	0.630	negative regulation of nitrogen compound metabolic process
GO:0006950	0.517	response to stress
GO:0001819	0.516	positive regulation of cytokine production
GO:0009967	0.510	positive regulation of signal transduction
GO:0070555	0.496	response to interleukin-1
GO:0051248	0.478	negative regulation of protein metabolic process
GO:0043086	0.464	negative regulation of catalytic activity
GO:1902532	0.457	negative regulation of intracellular signal transduction
GO:0051173	0.425	positive regulation of nitrogen compound metabolic process
GO:0006955	0.421	immune response
GO:1902533	0.417	positive regulation of intracellular signal transduction
GO:0006952	0.411	defense response
GO:0071347	0.392	cellular response to interleukin-1
GO:0031325	0.380	positive regulation of cellular metabolic process
GO:0002237	0.346	response to molecule of bacterial origin
GO:1901700	0.327	response to oxygen-containing compound
GO:0009615	0.313	response to virus
GO:0009894	0.311	regulation of catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005634	0.984	nucleus
GO:0005829	0.937	cytosol
GO:0016020	0.889	membrane
GO:0071944	0.888	cell periphery
GO:0005886	0.880	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]