StarFunc result for job id Q9Y618

User Input

>input (2514 residues)
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQ
PQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRP
SPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEA
AHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQ
RYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPM
KVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK
SLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVEN
DKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQ
SAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQ
NLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVVEDEEMEASGVSGNEEEMVEE
AEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPPATLGADGPPP
GPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEG
EEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGS
GRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKP
LDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPR
GKSRSPAPPADKEAFAAEAQKLPGDPPCWTSGLPFPVPPREVIKASPHAPDPSAFSYAPP
GHPLPLGLHDTARPVLPRPPTISNPPPLISSAKHPSVLERQIGAISQGMSVQLHVPYSEH
AKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEASVLRGTAL
GSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSPSRLDRGRE
DSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGR
AISSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKR
EGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELP
LAPRPLKEGSITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALE
RACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPFAGHLPRGSPV
TTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVSG
VDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRGYPDTAALE
NRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHL
PVLVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDR
DRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGGGGGSSSRPASHSHAHQHSPI
SPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTSTSSPVRPAATFPPATHCPLGG
TLDGVYPTLMEPVLLPKEAPRVARPERPRADTGHAFLAKPPARSGLEPASSPSKGSEPRP
LVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPHREKTQSKPFSIQELELRSLGY
HGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPGPVKLGGEAAHL
PHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPL
YSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKTSVLGGGEDGIE
PVSPPEGMTEPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFFSKLTESNSAMV
KSKKQEINKKLNTHNRNEPEYNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLE
AIIRKALMGKYDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDHTLTSPGGGGKA
KVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFP
YNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZXN9	0.226	0.229	0.000	2472	0.858	0.872	D3ZXN9.pdb.gz	D3ZXN9_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
2	AFDB:E7FF48	0.102	0.109	0.000	2315	0.508	0.552	E7FF48.pdb.gz	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
3	AFDB:Q9Y618	0.999	0.999	0.000	2514	1.000	1.000	Q9Y618.pdb.gz	NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3
4	AFDB:Q60974	0.088	0.089	9.472E-99	2453	0.413	0.423	Q60974.pdb.gz	NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus OX=10090 GN=Ncor1 PE=1 SV=1
5	AFDB:A0A2R8Q4C2	0.092	0.096	2.715E-80	2404	0.373	0.390	A0A2R8Q4C2.pdb.gz
6	AFDB:P18171	0.028	0.041	1.130E-4	1590	0.078	0.123	P18171.pdb.gz	DEC13_DROME Defective chorion protein, FC177 isoform OS=Drosophila melanogaster OX=7227 GN=dec PE=2 SV=2
7	PDB:4czzB	0.024	0.440	1.634E-4	133	0.011	0.203	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
8	AFDB:Q9UFD9	0.025	0.037	9.436E-4	1639	0.080	0.123	Q9UFD9.pdb.gz	RIM3A_HUMAN RIMS-binding protein 3A OS=Homo sapiens OX=9606 GN=RIMBP3 PE=1 SV=4
9	AFDB:Q00083	0.036	0.048	4.296E-3	1676	0.106	0.159	Q00083.pdb.gz	APSA_EMENI Anucleate primary sterigmata protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=apsA PE=1 SV=2
10	AFDB:P83741	0.027	0.028	9.448E-3	2377	0.111	0.118	P83741.pdb.gz	WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2
11	PDB:5l3cB	0.027	0.466	1.009E-2	134	0.010	0.194	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
12	AFDB:A6H8Y1	0.033	0.032	1.204E-2	2624	0.134	0.128	A6H8Y1.pdb.gz	BDP1_HUMAN Transcription factor TFIIIB component B'' homolog OS=Homo sapiens OX=9606 GN=BDP1 PE=1 SV=3
13	PDB:2cjjA	0.019	0.628	5.514E-1	63	0.004	0.175	2cjjA.pdb.gz
14	PDB:6tdaL	0.017	0.070	1.545	596	0.008	0.034	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
15	PDB:2hi3A	0.020	0.488	1.745	73	0.006	0.219	2hi3A.pdb.gz
16	PDB:6k15D	0.016	0.130	2.834	305	0.008	0.062	6k15D.pdb.gz	Structure of the RSC complex bound to the nucleosome.
17	PDB:4fe7A	0.018	0.104	3.199	380	0.004	0.029	4fe7A.pdb.gz	Structures of the Escherichia coli transcription activator and regulator of diauxie, XylR: an AraC DNA-binding family member with a LacI/GalR ligand-binding domain.
18	PDB:7egmE	0.014	0.082	4.332	422	0.005	0.031	7egmE.pdb.gz
19	PDB:6eu0V	0.019	0.160	4.603	273	0.009	0.084	6eu0V.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
20	PDB:6f40W	0.023	0.219	4.890	218	0.008	0.087	6f40W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JU91	0.0	4011	2511	0.872	0.873	A0A0G2JU91_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
2	A0A384DVL6	0.0	4141	2079	0.824	0.996	A0A384DVL6_HUMAN Nuclear receptor corepressor 2 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=1
3	A0A8I6A620	0.0	3851	2464	0.845	0.862	A0A8I6A620_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=1
4	A0A8I6AN60	0.0	3736	2453	0.829	0.849	A0A8I6AN60_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=1
5	A0A8I6GHM0	0.0	3457	2257	0.765	0.852	A0A8I6GHM0_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=1
6	A8B6H7	0.0	728	2409	0.171	0.179	A8B6H7_DANRE Nuclear receptor co-repressor OS=Danio rerio OX=7955 GN=ncor PE=1 SV=1
7	C9J0Q5	0.0	5001	2504	0.993	0.997	C9J0Q5_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=2
8	C9J7T7	0.0	4097	2062	0.817	0.996	C9J7T7_HUMAN Nuclear receptor corepressor 2 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3
9	C9JE98	0.0	4887	2458	0.975	0.997	C9JE98_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=1
10	C9JQE8	0.0	2900	1451	0.574	0.994	C9JQE8_HUMAN Nuclear receptor corepressor 2 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=1
11	D3ZXN9	0.0	3933	2477	0.858	0.871	D3ZXN9_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
12	E7EVU5	0.0	587	537	0.135	0.631	E7EVU5_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
13	E7EW50	0.0	597	545	0.135	0.624	E7EW50_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
14	E7FF48	0.0	1488	2315	0.414	0.449	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
15	J3KS51	0.0	588	546	0.135	0.623	J3KS51_HUMAN Nuclear receptor corepressor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1
16	O75376	0.0	780	2440	0.209	0.215	NCOR1_HUMAN Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2
17	Q9WU42	0.0	3936	2472	0.857	0.872	NCOR2_MOUSE Nuclear receptor corepressor 2 OS=Mus musculus OX=10090 GN=Ncor2 PE=1 SV=3
18	Q9Y618	0.0	5061	2514	1.000	1.000	NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3
19	Q60974	2.60e-97	355	2453	0.126	0.130	NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus OX=10090 GN=Ncor1 PE=1 SV=1
20	M9PGZ8	3.60e-68	259	3607	0.060	0.042	M9PGZ8_DROME Smrter, isoform G OS=Drosophila melanogaster OX=7227 GN=Smr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15784 GPS2_interact	2.5e-35	132.1	G-protein pathway suppressor 2-interacting domain
2	PF00249 Myb_DNA-binding	8.7e-15	66.0	Myb-like DNA-binding domain
3	PF13921 Myb_DNA-bind_6	39	15.9	Myb-like DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384018

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217964	0.999	F-box-like/WD repeat-containing protein TBL1X
2	9606.ENSP00000264606	0.999	Histone deacetylase 4
3	9606.ENSP00000287820	0.999	Peroxisome proliferator-activated receptor gamma
4	9606.ENSP00000302967	0.999	Histone deacetylase 3
5	9606.ENSP00000345206	0.999	Recombining binding protein suppressor of hairless
6	9606.ENSP00000362649	0.999	Histone deacetylase 1
7	9606.ENSP00000378402	0.999	Paired amphipathic helix protein Sin3a
8	9606.ENSP00000384371	0.999	B-cell lymphoma 6 protein
9	9606.ENSP00000385523	0.999	Peroxisome proliferator-activated receptor alpha
10	9606.ENSP00000405330	0.999	Estrogen receptor
11	9606.ENSP00000363822	0.998	Androgen receptor
12	9606.ENSP00000419692	0.998	Retinoic acid receptor RXR-alpha
13	9606.ENSP00000254066	0.997	Retinoic acid receptor alpha
14	9606.ENSP00000405574	0.997	F-box-like/WD repeat-containing protein TBL1XR1
15	9606.ENSP00000225983	0.993	Histone deacetylase 5
16	9606.ENSP00000379904	0.993	Thyroid hormone receptor beta
17	9606.ENSP00000370104	0.992	G protein pathway suppressor 2
18	9606.ENSP00000430432	0.992	Histone deacetylase 2
19	9606.ENSP00000336528	0.989	Nuclear receptor subfamily 1 group I member 2
20	9606.ENSP00000338157	0.989	Zinc finger and BTB domain-containing protein 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0044877	0.999	protein-containing complex binding
GO:0046965	0.999	nuclear retinoid X receptor binding
GO:0140110	0.997	transcription regulator activity
GO:0035259	0.992	nuclear glucocorticoid receptor binding
GO:0003714	0.991	transcription corepressor activity
GO:0019899	0.986	enzyme binding
GO:0042826	0.909	histone deacetylase binding
GO:0005102	0.878	signaling receptor binding
GO:0003676	0.864	nucleic acid binding
GO:0003677	0.842	DNA binding
GO:0005112	0.839	Notch binding
GO:0043565	0.660	sequence-specific DNA binding
GO:0003690	0.539	double-stranded DNA binding
GO:1990837	0.532	sequence-specific double-stranded DNA binding
GO:0000976	0.425	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0050896	0.988	response to stimulus
GO:0032501	0.976	multicellular organismal process
GO:0032502	0.965	developmental process
GO:0042221	0.962	response to chemical
GO:0065008	0.952	regulation of biological quality
GO:0050794	0.926	regulation of cellular process
GO:0019222	0.903	regulation of metabolic process
GO:0048856	0.900	anatomical structure development
GO:0010468	0.888	regulation of gene expression
GO:0019219	0.886	regulation of nucleobase-containing compound metabolic process
GO:0007275	0.879	multicellular organism development
GO:0031326	0.878	regulation of cellular biosynthetic process
GO:0010556	0.877	regulation of macromolecule biosynthetic process
GO:0051252	0.877	regulation of RNA metabolic process
GO:0010033	0.876	response to organic substance
GO:0009987	0.869	cellular process
GO:0006355	0.869	regulation of DNA-templated transcription
GO:0048731	0.863	system development
GO:0048513	0.852	animal organ development
GO:0006357	0.852	regulation of transcription by RNA polymerase II
GO:0007417	0.824	central nervous system development
GO:0050878	0.819	regulation of body fluid levels
GO:0048519	0.815	negative regulation of biological process
GO:0060322	0.804	head development
GO:0007420	0.786	brain development
GO:0048523	0.773	negative regulation of cellular process
GO:0048518	0.737	positive regulation of biological process
GO:0051179	0.734	localization
GO:0009892	0.724	negative regulation of metabolic process
GO:0010605	0.714	negative regulation of macromolecule metabolic process
GO:0030879	0.689	mammary gland development
GO:0031324	0.676	negative regulation of cellular metabolic process
GO:0045934	0.666	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.664	negative regulation of RNA metabolic process
GO:0051234	0.640	establishment of localization
GO:0045892	0.632	negative regulation of DNA-templated transcription
GO:0007589	0.608	body fluid secretion
GO:0048522	0.590	positive regulation of cellular process
GO:0048583	0.588	regulation of response to stimulus
GO:0030902	0.581	hindbrain development
GO:0010646	0.558	regulation of cell communication
GO:0023051	0.553	regulation of signaling
GO:0000122	0.539	negative regulation of transcription by RNA polymerase II
GO:1901700	0.525	response to oxygen-containing compound
GO:0048511	0.504	rhythmic process
GO:0009893	0.470	positive regulation of metabolic process
GO:0014070	0.468	response to organic cyclic compound
GO:0010604	0.461	positive regulation of macromolecule metabolic process
GO:0008152	0.459	metabolic process
GO:0033993	0.458	response to lipid
GO:1901698	0.452	response to nitrogen compound
GO:0032355	0.445	response to estradiol
GO:0071704	0.442	organic substance metabolic process
GO:0009966	0.441	regulation of signal transduction
GO:0044238	0.431	primary metabolic process
GO:0051173	0.424	positive regulation of nitrogen compound metabolic process
GO:0007595	0.404	lactation
GO:0051716	0.403	cellular response to stimulus
GO:0006807	0.400	nitrogen compound metabolic process
GO:0021549	0.398	cerebellum development
GO:0042698	0.386	ovulation cycle
GO:0010243	0.356	response to organonitrogen compound
GO:0031325	0.355	positive regulation of cellular metabolic process
GO:0043170	0.352	macromolecule metabolic process
GO:0045935	0.322	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005694	0.939	chromosome
GO:0032991	0.911	protein-containing complex
GO:0000785	0.906	chromatin
GO:0005737	0.738	cytoplasm
GO:0005829	0.411	cytosol
GO:0017053	0.389	transcription repressor complex
GO:0016363	0.367	nuclear matrix
GO:0016604	0.343	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]