StarFunc result for job id Q9Y619

User Input

>input (301 residues)
MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGF
RGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFA
ALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLRE
VPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVL
SMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEA
Y

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K309	0.992	0.992	1.371E-36	301	0.944	0.944	A0A0G2K309.pdb.gz	ORNT1_RAT Mitochondrial ornithine transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc25a15 PE=1 SV=1
2	AFDB:Q9BXI2	0.993	0.993	8.909E-35	301	0.874	0.874	Q9BXI2.pdb.gz	ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens OX=9606 GN=SLC25A2 PE=1 SV=3
3	AFDB:Q99ML6	0.759	0.851	2.223E-23	265	0.658	0.747	Q99ML6.pdb.gz	Q99ML6_MOUSE Mutant ornithine transporter 2 OS=Mus musculus OX=10090 GN=Slc25a2 PE=2 SV=1
4	AFDB:Q93XM7	0.844	0.846	2.591E-17	300	0.352	0.353	Q93XM7.pdb.gz	MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=BOU PE=1 SV=1
5	AFDB:Q84UC7	0.845	0.820	1.963E-16	311	0.316	0.305	Q84UC7.pdb.gz	BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana OX=3702 GN=BAC1 PE=1 SV=1
6	AFDB:Q385N9	0.819	0.870	2.046E-16	282	0.302	0.323	Q385N9.pdb.gz	Q385N9_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2960 PE=3 SV=1
7	AFDB:O43772	0.788	0.788	2.847E-16	301	0.316	0.316	O43772.pdb.gz	MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens OX=9606 GN=SLC25A20 PE=1 SV=1
8	AFDB:Q9VQG4	0.788	0.776	9.439E-16	306	0.306	0.301	Q9VQG4.pdb.gz	COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster OX=7227 GN=colt PE=2 SV=1
9	AFDB:P32331	0.844	0.828	3.003E-15	307	0.316	0.309	P32331.pdb.gz	YMC1_YEAST Mitochondrial glycine transporter YMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMC1 PE=1 SV=2
10	AFDB:Q8BW66	0.821	0.808	6.584E-15	306	0.286	0.281	Q8BW66.pdb.gz	S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus OX=10090 GN=Slc25a48 PE=1 SV=2
11	PDB:4c9qB	0.728	0.754	1.272E-9	290	0.203	0.210	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.728	0.746	7.215E-9	293	0.186	0.191	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.515	0.526	3.659E-7	292	0.196	0.202	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:7ehlA	0.146	0.093	7.212E-2	563	0.166	0.089	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.
15	PDB:7f04C	0.178	0.216	8.164E-2	231	0.136	0.177	7f04C.pdb.gz	Structures of the CcmABCD heme release complex at multiple states.
16	PDB:6s7tA	0.166	0.090	8.508E-2	706	0.163	0.069	6s7tA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
17	PDB:7oseB	0.188	0.164	8.508E-2	377	0.106	0.085	7oseB.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
18	PDB:4f4cA	0.129	0.048	1.004E-1	1250	0.116	0.028	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
19	PDB:6ibbA	0.181	0.181	1.004E-1	301	0.110	0.110	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
20	PDB:7cz5R	0.174	0.190	1.090E-1	269	0.100	0.112	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K309	0.0	568	301	0.944	0.944	ORNT1_RAT Mitochondrial ornithine transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc25a15 PE=1 SV=1
2	Q9BXI2	0.0	519	301	0.874	0.874	ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens OX=9606 GN=SLC25A2 PE=1 SV=3
3	Q9WVD5	0.0	572	301	0.950	0.950	ORNT1_MOUSE Mitochondrial ornithine transporter 1 OS=Mus musculus OX=10090 GN=Slc25a15 PE=1 SV=1
4	Q9Y619	0.0	619	301	1.000	1.000	ORNT1_HUMAN Mitochondrial ornithine transporter 1 OS=Homo sapiens OX=9606 GN=SLC25A15 PE=1 SV=1
5	Q99ML6	1.47e-143	406	265	0.658	0.747	Q99ML6_MOUSE Mutant ornithine transporter 2 OS=Mus musculus OX=10090 GN=Slc25a2 PE=2 SV=1
6	Q93XM7	2.09e-51	173	300	0.362	0.363	MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=BOU PE=1 SV=1
7	Q385N9	1.12e-44	155	282	0.299	0.319	Q385N9_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2960 PE=3 SV=1
8	Q27257	1.06e-41	148	312	0.312	0.301	DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans OX=6239 GN=dif-1 PE=2 SV=1
9	P97521	1.92e-41	147	301	0.322	0.322	MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus OX=10116 GN=Slc25a20 PE=1 SV=1
10	O43772	2.05e-41	147	301	0.316	0.316	MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens OX=9606 GN=SLC25A20 PE=1 SV=1
11	Q9Z2Z6	2.43e-41	147	301	0.316	0.316	MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus OX=10090 GN=Slc25a20 PE=1 SV=1
12	Q8CFJ7	6.17e-41	145	288	0.309	0.323	S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus OX=10090 GN=Slc25a45 PE=1 SV=1
13	Q9VM51	1.11e-39	142	299	0.312	0.314	MME1_DROME Mitochondrial magnesium exporter 1 OS=Drosophila melanogaster OX=7227 GN=MME1 PE=2 SV=1
14	Q9VQG4	3.25e-39	141	306	0.309	0.304	COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster OX=7227 GN=colt PE=2 SV=1
15	Q84UC7	3.73e-39	141	311	0.312	0.302	BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana OX=3702 GN=BAC1 PE=1 SV=1
16	Q12289	2.47e-38	139	327	0.319	0.294	CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRC1 PE=1 SV=1
17	Q4WBL9	3.31e-38	139	324	0.342	0.318	Q4WBL9_ASPFU Mitochondrial ornithine carrier protein AmcA/Ort1, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G02760 PE=3 SV=1
18	Q387M4	3.06e-37	136	310	0.296	0.287	Q387M4_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0870 PE=3 SV=1
19	Q8N8R3	8.70e-35	129	303	0.322	0.320	S2529_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens OX=9606 GN=SLC25A29 PE=1 SV=2
20	Q12375	1.41e-34	129	292	0.316	0.325	ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	6.3e-58	204.0	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000013861

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003432	0.658	Ubiquinol-cytochrome c reductase core protein II
2	60711.ENSCSAP00000014865	0.602	ERCC excision repair 1, endonuclease non-catalytic subunit
3	60711.ENSCSAP00000000440	0.559	RAB21, member RAS oncogene family
4	60711.ENSCSAP00000014492	0.559	Granulin
5	60711.ENSCSAP00000015403	0.551	CDGSH iron sulfur domain 3
6	60711.ENSCSAP00000015759	0.524	BICD family like cargo adaptor 1
7	60711.ENSCSAP00000006545	0.523	XK-related protein
8	60711.ENSCSAP00000009240	0.520	Solute carrier family 23 (ascorbic acid transporter), member 1
9	60711.ENSCSAP00000006823	0.502	8-oxoguanine DNA glycosylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015179	0.998	L-amino acid transmembrane transporter activity
GO:1901702	0.996	salt transmembrane transporter activity
GO:0015297	0.995	antiporter activity
GO:0061459	0.992	L-arginine transmembrane transporter activity
GO:0015189	0.992	L-lysine transmembrane transporter activity
GO:0005488	0.914	binding
GO:0005515	0.813	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044237	0.993	cellular metabolic process
GO:1990542	0.992	mitochondrial transmembrane transport
GO:0006807	0.989	nitrogen compound metabolic process
GO:0015849	0.987	organic acid transport
GO:0015711	0.982	organic anion transport
GO:0071704	0.977	organic substance metabolic process
GO:0072337	0.973	modified amino acid transport
GO:1905039	0.970	carboxylic acid transmembrane transport
GO:0015807	0.955	L-amino acid transport
GO:1902475	0.901	L-alpha-amino acid transmembrane transport
GO:0071941	0.896	nitrogen cycle metabolic process
GO:0044238	0.834	primary metabolic process
GO:0044281	0.825	small molecule metabolic process
GO:0034641	0.797	cellular nitrogen compound metabolic process
GO:1901564	0.739	organonitrogen compound metabolic process
GO:0009058	0.704	biosynthetic process
GO:1901576	0.678	organic substance biosynthetic process
GO:0044249	0.661	cellular biosynthetic process
GO:1901566	0.655	organonitrogen compound biosynthetic process
GO:0044271	0.646	cellular nitrogen compound biosynthetic process
GO:0043603	0.549	amide metabolic process
GO:0043604	0.529	amide biosynthetic process
GO:0015802	0.525	basic amino acid transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.985	membrane
GO:0031090	0.917	organelle membrane
GO:0031967	0.898	organelle envelope
GO:0005740	0.837	mitochondrial envelope
GO:0031966	0.791	mitochondrial membrane
GO:0005743	0.758	mitochondrial inner membrane
GO:0070013	0.466	intracellular organelle lumen
GO:0005634	0.353	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:32143	0.992	L-arginine(in) = L-arginine(out)

[back to server]