StarFunc result for job id Q9Y623

User Input

>input (1939 residues)
MSSDSEMAIFGEAAPFLRKSEKERIEAQNKPFDAKTSVFVVDPKESYVKAIVQSREGGKV
TAKTEAGATVTVKEDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYNPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVTGEKKKEEPASGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPEL
IEMLLITTNPYDFAFVSQGEITVPSIDDQEELMATDSAVDILGFTADEKVAIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLKSLCYPRVKVGNEFVTKGQTV
QQVYNAVGALAKAIYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLVHYAGTVDYNIAGWLDKN
KDPLNETVVGLYQKSAMKTLAFLFSGAQTAEAEGGGGKKGGKKKGSSFQTVSALFRENLN
KLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYA
DFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIEIDHTQYKFGHTKVFFKAGLLGTLEEM
RDEKLAQLITRTQAICRGFLMRVEFRKMMERRESIFCIQYNIRAFMNVKHWPWMKLYFKI
KPLLKSAETEKEMANMKEEFEKTKEELAKTEAKRKELEEKMVTLMQEKNDLQLQVQAEAD
ALADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDD
LELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQMEEDK
VNTLTKAKTKLEQQVDDLEGSLEQEKKLCMDLERAKRKLEGDLKLAQESTMDTENDKQQL
NEKLKKKEFEMSNLQGKIEDEQALAIQLQKKIKELQARIEELEEEIEAERASRAKAEKQR
SDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEESTLQHEATAAALRKKH
ADSVAELGEQIDSLQRVKQKLEKEKSELKMEINDLASNMETVSKAKANFEKMCRTLEDQL
SEIKTKEEEQQRLINELSAQKARLHTESGEFSRQLDEKDAMVSQLSRGKQAFTQQIEELK
RQLEEETKAKSTLAHALQSARHDCDLLREQYEEEQEAKAELQRGMSKANSEVAQWRTKYE
TDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNSKCASLEKTKQRLQNEVEDLMIDVERSN
AACIALDKKQRNFDKVLAEWKQKYEETQAELEASQKESRSLSTELFKVKNAYEESLDHLE
TLKRENKNLQQEISDLTEQIAEGGKHIHELEKVKKQLDHEKSELQTSLEEAEASLEHEEG
KILRIQLELNQVKSEIDRKIAEKDEELDQLKRNHLRVVESMQSTLDAEIRSRNDALRIKK
KMEGDLNEMEIQLNHANRQAAEALRNLRNTQGILKDTQLHLDDAIRGQDDLKEQLAMVER
RANLMQAEVEELRASLERTERGRKMAEQELLDASERVQLLHTQNTSLINTKKKLETDISQ
IQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQLR
LDEAEQLALKGGKKQIQKLEARVRELESEVESEQKHNVEAVKGLRKHERRVKELTYQTEE
DRKNILRLQDLVDKLQTKVKAYKRQAEEAEEQSNVNLAKFRKLQHELEEAKERADIAESQ
VNKLRVKSREVHTKVISEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4pa0A	0.340	0.656	0.000	974	0.321	0.640	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
2	AFDB:A0A0G2JY53	0.709	0.718	0.000	1915	0.544	0.550	A0A0G2JY53.pdb.gz	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
3	AFDB:A0A0N4STT5	0.698	0.675	0.000	2008	0.792	0.765	A0A0N4STT5.pdb.gz
4	AFDB:A7E2Y1	0.691	0.676	0.000	1983	0.667	0.653	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
5	AFDB:B1AR69	0.762	0.762	0.000	1938	0.816	0.816	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
6	AFDB:B3DFS9	0.658	0.647	0.000	1974	0.395	0.388	B3DFS9.pdb.gz
7	AFDB:B8A568	0.743	0.744	0.000	1937	0.822	0.823	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
8	AFDB:B8JLS3	0.775	0.776	0.000	1936	0.759	0.760	B8JLS3.pdb.gz
9	AFDB:E7FD18	0.773	0.771	0.000	1945	0.716	0.714	E7FD18.pdb.gz
10	AFDB:F1QC64	0.643	0.710	0.000	1749	0.351	0.389	F1QC64.pdb.gz
11	AFDB:F1R3G4	0.718	0.700	0.000	1992	0.384	0.374	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
12	PDB:4pa0B	0.340	0.696	3.775E-102	920	0.314	0.661	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4p7hB	0.340	0.675	3.045E-96	952	0.311	0.633	4p7hB.pdb.gz
14	PDB:5tbyA	0.366	0.708	1.635E-94	954	0.395	0.803	5tbyA.pdb.gz
15	PDB:7mf3B	0.364	0.766	4.255E-66	896	0.226	0.490	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
16	PDB:4anjA	0.343	0.657	3.334E-61	995	0.138	0.268	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.360	0.810	1.363E-55	817	0.123	0.293	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:6fyxo	0.042	0.093	4.500E-2	529	0.034	0.123	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
19	PDB:7wrgA	0.057	0.118	1.516E-1	812	0.038	0.090	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
20	PDB:2is4B	0.040	0.074	1.841E-1	632	0.030	0.093	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	2092	1922	0.558	0.562	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	3603	1912	0.914	0.927	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	3660	1937	0.925	0.926	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	3742	1939	0.955	0.955	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	3095	1938	0.792	0.792	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	706	1948	0.215	0.214	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	2519	1941	0.670	0.670	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	1284	1972	0.401	0.394	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	2521	1983	0.668	0.653	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	3222	1938	0.817	0.817	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	3124	1939	0.792	0.792	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	2549	1941	0.669	0.669	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	3200	1937	0.823	0.823	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	3756	1939	0.958	0.958	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	3670	1943	0.932	0.931	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	3130	1938	0.797	0.797	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	1232	1992	0.389	0.379	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	2484	1929	0.653	0.657	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	3626	1942	0.918	0.917	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	3637	1942	0.922	0.921	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	4e+02	12.7	AAA domain
2	PF19220 Crescentin	22	15.6	Crescentin protein
3	PF00038 Filament	12	17.0	Intermediate filament protein
4	PF00612 IQ	71	14.6	IQ calmodulin-binding motif
5	PF00063 Myosin_head	2.7e-283	953.0	Myosin head (motor domain)
6	PF02736 Myosin_N	1e-11	55.6	Myosin N-terminal SH3-like domain
7	PF01576 Myosin_tail_1	3.9e-161	550.0	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255381

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307280	0.973	Myosin light chain 1/3, skeletal muscle isoform
2	9606.ENSP00000325239	0.966	Myosin light chain, phosphorylatable, fast skeletal muscle
3	9606.ENSP00000450385	0.961	Myosin light chain 6B
4	9606.ENSP00000279022	0.953	Myosin regulatory light polypeptide 9
5	9606.ENSP00000383023	0.944	Myosin light chain 5
6	9606.ENSP00000379210	0.943	Myosin light chain 3
7	9606.ENSP00000463559	0.902	Myosin regulatory light chain 12B
8	9606.ENSP00000351022	0.863	Tropomyosin alpha-1 chain
9	9606.ENSP00000443495	0.863	Alpha-actinin-2
10	9606.ENSP00000217652	0.856	Myosin regulatory light chain 12A
11	9606.ENSP00000226207	0.833	Myosin-1
12	9606.ENSP00000278317	0.830	Troponin T, fast skeletal muscle
13	9606.ENSP00000223167	0.815	Myosin regulatory light chain 10
14	9606.ENSP00000352272	0.810	Myozenin-1
15	9606.ENSP00000361636	0.806	Troponin C, skeletal muscle
16	9606.ENSP00000347055	0.805	Myosin light chain 4
17	9606.ENSP00000228841	0.799	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
18	9606.ENSP00000371331	0.799	Troponin I, fast skeletal muscle
19	9606.ENSP00000384330	0.799	Myosin-8
20	9606.ENSP00000446955	0.797	Myosin light polypeptide 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0000146	0.998	microfilament motor activity
GO:0008092	0.898	cytoskeletal protein binding
GO:0003779	0.869	actin binding
GO:0005198	0.797	structural molecule activity
GO:0044877	0.750	protein-containing complex binding
GO:0008307	0.715	structural constituent of muscle
GO:0051015	0.308	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.990	multicellular organismal process
GO:0009987	0.986	cellular process
GO:0003012	0.980	muscle system process
GO:0006936	0.954	muscle contraction
GO:0006941	0.917	striated muscle contraction
GO:0016043	0.904	cellular component organization
GO:0030029	0.859	actin filament-based process
GO:0050896	0.798	response to stimulus
GO:0030036	0.784	actin cytoskeleton organization
GO:0032502	0.743	developmental process
GO:0031033	0.725	myosin filament organization
GO:0031034	0.724	myosin filament assembly
GO:0014823	0.715	response to activity
GO:0065007	0.686	biological regulation
GO:0048856	0.674	anatomical structure development
GO:0050789	0.641	regulation of biological process
GO:0061061	0.352	muscle structure development
GO:0050794	0.312	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043292	1.000	contractile fiber
GO:0032991	0.998	protein-containing complex
GO:0015629	0.998	actin cytoskeleton
GO:0016459	0.976	myosin complex
GO:0005829	0.928	cytosol
GO:0005859	0.867	muscle myosin complex
GO:0030016	0.693	myofibril
GO:0043227	0.681	membrane-bounded organelle
GO:0043231	0.506	intracellular membrane-bounded organelle
GO:0030017	0.415	sarcomere

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.998	myosin ATPase.

[back to server]